Search Antibody, Protein, and ELISA Kit Solutions

ADSL Antibody - middle region (ARP84486_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
adenylosuccinate lyase
NCBI Gene Id:
Protein Name:
adenylosuccinate lyase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene.
Protein Size (# AA):
Molecular Weight:
53 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADSL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADSL.
The immunogen is a synthetic peptide directed towards the middle region of human ADSL
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: ASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLAR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ADSL (ARP84486_P050) antibody is Catalog # AAP84486
Printable datasheet for anti-ADSL (ARP84486_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...