SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP87738_P050
Price: $0.00
SKU
ARP87738_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ADRM1 (ARP87738_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: LMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDM
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADRM1 (ARP87738_P050) antibody is Catalog # AAP87738
Gene SymbolADRM1
Gene Full Nameadhesion regulating molecule 1
Alias SymbolsARM1, ARM-1, GP110, PSMD16
NCBI Gene Id11047
Protein Nameproteasomal ubiquitin receptor ADRM1
Description of TargetThis gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5. Increased levels of the encoded protein are associated with increased cell adhesion, which is likely an indirect effect of this intracellular protein. Dysregulation of this gene has been implicated in carcinogenesis. Alternative splicing results in multiple transcript variants.
Uniprot IDQ16186
Protein Accession #NP_001268366.1
Nucleotide Accession #NM_001281437.1
Protein Size (# AA)407
Molecular Weight44 kDa
  1. What is the species homology for "ADRM1 Antibody - C-terminal region (ARP87738_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ADRM1 Antibody - C-terminal region (ARP87738_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "ADRM1 Antibody - C-terminal region (ARP87738_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADRM1 Antibody - C-terminal region (ARP87738_P050)"?

    This target may also be called "ARM1, ARM-1, GP110, PSMD16" in publications.

  5. What is the shipping cost for "ADRM1 Antibody - C-terminal region (ARP87738_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADRM1 Antibody - C-terminal region (ARP87738_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADRM1 Antibody - C-terminal region (ARP87738_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADRM1 Antibody - C-terminal region (ARP87738_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADRM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADRM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADRM1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADRM1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADRM1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADRM1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADRM1 Antibody - C-terminal region (ARP87738_P050)
Your Rating
We found other products you might like!