Catalog No: ARP36551_P050
Price: $0.00
SKU
ARP36551_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ADRB1 (ARP36551_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ADRB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 87%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADRB1 (ARP36551_P050) antibody is Catalog # AAP36551 (Previous Catalog # AAPP07702)
Enhanced Validation
WBY
SPRY
YCHAROS
ReferenceUlucan,C., (er) J. Cardiovasc. Electrophysiol. (2008) In press
Publications

Propranolol sensitizes thyroid cancer cells to cytotoxic effect of vemurafenib. Oncol. Rep. 36, 1576-84 (2016). 27432558

Tsai, W.-C. et al. Testosterone replacement increases aged pulmonary vein and left atrium arrhythmogenesis with enhanced adrenergic activity. Int. J. Cardiol. 176, 110-8 (2014). 25037694

Gene SymbolADRB1
Gene Full NameAdrenergic, beta-1-, receptor
Alias SymbolsRHR, B1AR, FNSS2, ADRB1R, BETA1AR
NCBI Gene Id153
Protein NameBeta-1 adrenergic receptor
Description of TargetThe adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP08588
Protein Accession #NP_000675
Nucleotide Accession #NM_000684
Protein Size (# AA)477
Molecular Weight51 kDa
Protein InteractionsGPRASP1; GPRASP2; SNTA1; ARRB2; ARRB1; MAGI2; DLG4; GRB2; ADRA2A; MAGI3; DLGAP2; GOPC; GIPC1; SH3GL2; SH3GL3; DLG1; NOS1;
  1. What is the species homology for "ADRB1 antibody - middle region (ARP36551_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "ADRB1 antibody - middle region (ARP36551_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADRB1 antibody - middle region (ARP36551_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADRB1 antibody - middle region (ARP36551_P050)"?

    This target may also be called "RHR, B1AR, FNSS2, ADRB1R, BETA1AR" in publications.

  5. What is the shipping cost for "ADRB1 antibody - middle region (ARP36551_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADRB1 antibody - middle region (ARP36551_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADRB1 antibody - middle region (ARP36551_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADRB1 antibody - middle region (ARP36551_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADRB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADRB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADRB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADRB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADRB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADRB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADRB1 antibody - middle region (ARP36551_P050)
Your Rating
We found other products you might like!