ADRB1 antibody - middle region (ARP36551_P050)

Catalog No: ARP36551_P050

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Host: Rabbit
Target Name: ADRB1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: ADRB1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: ADRB1
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: ADRB1
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: ADRB1
Positive control (+): Mouse liver (M-LI)
Negative control (-): Mouse spleen (M-SP)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADRB1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 87%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADRB1 (ARP36551_P050) antibody is Catalog # AAP36551 (Previous Catalog # AAPP07702)
• Enhanced Validation:

  WB	Y
  SPR	Y
  YCHAROS

• Reference: Ulucan,C., (er) J. Cardiovasc. Electrophysiol. (2008) In press
• Publications:

  Propranolol sensitizes thyroid cancer cells to cytotoxic effect of vemurafenib. Oncol. Rep. 36, 1576-84 (2016). 27432558

  Tsai, W.-C. et al. Testosterone replacement increases aged pulmonary vein and left atrium arrhythmogenesis with enhanced adrenergic activity. Int. J. Cardiol. 176, 110-8 (2014). 25037694

Target Info

• Gene Symbol: ADRB1
• Gene Full Name: Adrenergic, beta-1-, receptor
• Alias Symbols: RHR, B1AR, FNSS2, ADRB1R, BETA1AR
• NCBI Gene Id: 153
• Protein Name: Beta-1 adrenergic receptor
• Description of Target: The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P08588
• Protein Accession #: NP_000675
• Nucleotide Accession #: NM_000684
• Protein Size (# AA): 477
• Molecular Weight: 51 kDa
• Protein Interactions: GPRASP1; GPRASP2; SNTA1; ARRB2; ARRB1; MAGI2; DLG4; GRB2; ADRA2A; MAGI3; DLGAP2; GOPC; GIPC1; SH3GL2; SH3GL3; DLG1; NOS1;