Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36551_P050-FITC Conjugated

ARP36551_P050-HRP Conjugated

ARP36551_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-29580 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADRB1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 87%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-ADRB1 (ARP36551_P050)
Peptide Sequence Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ADRB1 (ARP36551_P050) antibody is Catalog # AAP36551 (Previous Catalog # AAPP07702)
Datasheets/Manuals Printable datasheet for anti-ADRB1 (ARP36551_P050) antibody
Target Reference Ulucan,C., (er) J. Cardiovasc. Electrophysiol. (2008) In press

Tsai, W.-C. et al. Testosterone replacement increases aged pulmonary vein and left atrium arrhythmogenesis with enhanced adrenergic activity. Int. J. Cardiol. 176, 110-8 (2014). WB, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 25037694

Wei, WJ; Shen, CT; Song, HJ; Qiu, ZL; Luo, QY; Propranolol sensitizes thyroid cancer cells to cytotoxic effect of vemurafenib. 36, 1576-84 (2016). WB, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 27432558

Gene Symbol ADRB1
Official Gene Full Name Adrenergic, beta-1-, receptor
Alias Symbols ADRB1R, B1AR, BETA1AR, RHR
NCBI Gene Id 153
Protein Name Beta-1 adrenergic receptor
Description of Target The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P08588
Protein Accession # NP_000675
Nucleotide Accession # NM_000684
Protein Size (# AA) 477
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADRB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADRB1.
Write Your Own Review
You're reviewing:ADRB1 Antibody - middle region (ARP36551_P050)
Your Rating