Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP59952_P050
Price: $0.00
SKU
ARP59952_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ADORA2A Antibody - N-terminal region (ARP59952_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ADORA2A (ARP59952_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Dog, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ADORA2A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Human: 100%; Rabbit: 85%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: SFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFN
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADORA2A (ARP59952_P050) antibody is Catalog # AAP59952 (Previous Catalog # AAPP46336)
Gene SymbolADORA2A
Gene Full NameAdenosine A2a receptor
Alias SymbolsA2aR, RDC8, ADORA2
NCBI Gene Id135
Protein NameAdenosine receptor A2a
Description of TargetADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.
Uniprot IDP29274
Protein Accession #NP_000666
Nucleotide Accession #NM_000675
Protein Size (# AA)412
Molecular Weight45kDa
Protein InteractionsNAMPT; Actn1; Actn4; Actn3; Actn2; ADORA2A; CYTH2; DRD2; ADA;
  1. What is the species homology for "ADORA2A Antibody - N-terminal region (ARP59952_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Dog, Rabbit".

  2. How long will it take to receive "ADORA2A Antibody - N-terminal region (ARP59952_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADORA2A Antibody - N-terminal region (ARP59952_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADORA2A Antibody - N-terminal region (ARP59952_P050)"?

    This target may also be called "A2aR, RDC8, ADORA2" in publications.

  5. What is the shipping cost for "ADORA2A Antibody - N-terminal region (ARP59952_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADORA2A Antibody - N-terminal region (ARP59952_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADORA2A Antibody - N-terminal region (ARP59952_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADORA2A Antibody - N-terminal region (ARP59952_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADORA2A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADORA2A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADORA2A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADORA2A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADORA2A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADORA2A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADORA2A Antibody - N-terminal region (ARP59952_P050)
Your Rating
We found other products you might like!