Search Antibody, Protein, and ELISA Kit Solutions

ADORA2A antibody - C-terminal region (ARP59953_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59953_P050-FITC Conjugated

ARP59953_P050-HRP Conjugated

ARP59953_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Adenosine A2a receptor
Protein Name:
Adenosine receptor A2a
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADORA2A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADORA2A.
The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA2A
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 80%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-ADORA2A (ARP59953_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NAMPT; Actn1; Actn4; Actn3; Actn2; ADORA2A; CYTH2; DRD2; ADA;
Blocking Peptide:
For anti-ADORA2A (ARP59953_P050) antibody is Catalog # AAP59953 (Previous Catalog # AAPP46115)
Printable datasheet for anti-ADORA2A (ARP59953_P050) antibody
Sample Type Confirmation:

ADORA2A is supported by BioGPS gene expression data to be expressed in RPMI 8226

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...