- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for ADNP Antibody (OAAL00600) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 2C5 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | ADNP |
|---|---|
| Gene Full Name | activity dependent neuroprotector homeobox |
| Alias Symbols | activity-dependent neuroprotective protein;activity-dependent neuroprotector;activity-dependent neuroprotector homeobox protein;ADNP homeobox 1;ADNP1;HVDAS;MRD28. |
| NCBI Gene Id | 23394 |
| Protein Name | activity-dependent neuroprotector homeobox protein [Homo sapiens]|Homo sapiens activity dependent neuroprotector homeobox (ADNP), transcript variant 1, mRNA |
| Description of Target | Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_056154 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_015339 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ADNP Antibody (OAAL00600)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "ADNP Antibody (OAAL00600)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "ADNP Antibody (OAAL00600)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ADNP Antibody (OAAL00600)"?
This target may also be called "activity-dependent neuroprotective protein;activity-dependent neuroprotector;activity-dependent neuroprotector homeobox protein;ADNP homeobox 1;ADNP1;HVDAS;MRD28." in publications.
-
What is the shipping cost for "ADNP Antibody (OAAL00600)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ADNP Antibody (OAAL00600)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ADNP Antibody (OAAL00600)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ADNP Antibody (OAAL00600)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ADNP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ADNP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ADNP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ADNP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ADNP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ADNP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
