SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP64721_P050
Price: $0.00
SKU
ARP64721_P050
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ADM2 (ARP64721_P050) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 83%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolADM2
Gene Full Nameadrenomedullin 2
Alias SymbolsAM2, dJ579N16.4
NCBI Gene Id79924
Protein NameADM2
Description of TargetThis gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues, acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Uniprot IDQ7Z4H4
Protein Accession #NP_079142
Nucleotide Accession #NM_001253845
Protein Size (# AA)148
Molecular Weight16 kDa
  1. What is the species homology for "ADM2 Antibody (ARP64721_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig".

  2. How long will it take to receive "ADM2 Antibody (ARP64721_P050)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "ADM2 Antibody (ARP64721_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADM2 Antibody (ARP64721_P050)"?

    This target may also be called "AM2, dJ579N16.4" in publications.

  5. What is the shipping cost for "ADM2 Antibody (ARP64721_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADM2 Antibody (ARP64721_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADM2 Antibody (ARP64721_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADM2 Antibody (ARP64721_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADM2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADM2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADM2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADM2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADM2 Antibody (ARP64721_P050)
Your Rating