ADM Antibody - C-terminal region (ARP51920_P050)

Catalog No: ARP51920_P050

WB Suggested Anti-ADM Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 91%
• Peptide Sequence: Synthetic peptide located within the following region: VAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADM (ARP51920_P050) antibody is Catalog # AAP51920

Target Info

• Gene Symbol: ADM
• Gene Full Name: Adrenomedullin
• Alias Symbols: AM, PAMP
• NCBI Gene Id: 133
• Protein Name: ADM
• Description of Target: Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element.
• Uniprot ID: P35318
• Protein Accession #: NP_001115
• Nucleotide Accession #: NM_001124
• Protein Size (# AA): 185
• Molecular Weight: 20kDa
• Protein Interactions: CALCRL; EDN1; CFH; MME; ADM;