ADK Recombinant Protein (Mycobacterium tuberculosis) (OPCA05281)

Catalog No: OPCA05281

Product Info

• Predicted Species Reactivity: Mycobacterium tuberculosis
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 85% as determined by SDS-PAGE.
• Peptide Sequence: MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
• Protein Sequence: MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-181 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. Zheng H., Lu L., Wang B., Pu S., Zhang X., Zhu G., Shi W., Zhang L., Wang H., Wang S., Zhao G., Zhang Y. PLoS ONE 3:E2375-E2375(2008)

Target Info

• Gene Symbol: ADK
• Alias Symbols: Adenylate monophosphate kinase;ATP:AMP phosphotransferase;ATP-AMP transphosphorylase.
• Protein Name: Adenylate kinase
• Description of Target: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
• Uniprot ID: A5U0B9
• Protein Accession #: WP_003403726
• Nucleotide Accession #: NC_009525
• Protein Size (# AA): Recombinant
• Molecular Weight: 36.1 kDa