Size:100 ul
$229.00
In stock
SKU
ARP41789_T100-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41789_T100 Unconjugated

ARP41789_T100-FITC Conjugated

ARP41789_T100-Biotin Conjugated

ADH6 Antibody - middle region : HRP (ARP41789_T100-HRP)

Catalog#: ARP41789_T100-HRP
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-100495 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADH6
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79%
Complete computational species homology data Anti-ADH6 (ARP41789_T100)
Peptide Sequence Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
Concentration 0.5 mg/ml
Blocking Peptide For anti-ADH6 (ARP41789_T100-HRP) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837)
Datasheets/Manuals Printable datasheet for anti-ADH6 (ARP41789_T100-HRP) antibody
Sample Type Confirmation

ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Gene Symbol ADH6
Official Gene Full Name Alcohol dehydrogenase 6 (class V)
Alias Symbols ADH-5
NCBI Gene Id 130
Protein Name ADH6 protein EMBL AAH39065.1
Description of Target ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
Swissprot Id Q8IUN7
Protein Accession # AAH39065
Nucleotide Accession # NM_000672
Protein Size (# AA) 295
Molecular Weight 32kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADH6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADH6.
Protein Interactions RPAIN; RASSF5; RSL1D1; ANKRD17; TNIP1; RPS29; KRAS; ARRB1;
Write Your Own Review
You're reviewing:ADH6 Antibody - middle region : HRP (ARP41789_T100-HRP)
Your Rating