Search Antibody, Protein, and ELISA Kit Solutions

ADH6 Antibody - middle region : HRP (ARP41789_T100-HRP)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41789_T100 Unconjugated

ARP41789_T100-FITC Conjugated

ARP41789_T100-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
ADH6
Official Gene Full Name:
Alcohol dehydrogenase 6 (class V)
NCBI Gene Id:
130
Protein Name:
ADH6 protein EMBL AAH39065.1
Swissprot Id:
Q8IUN7
Protein Accession #:
AAH39065
Nucleotide Accession #:
NM_000672
Alias Symbols:
ADH-5
Replacement Item:
This antibody may replace item sc-100495 from Santa Cruz Biotechnology.
Description of Target:
ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
Protein Size (# AA):
295
Molecular Weight:
32kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADH6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADH6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ADH6
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-ADH6 (ARP41789_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
Concentration:
0.5 mg/ml
Protein Interactions:
RPAIN; RASSF5; RSL1D1; ANKRD17; TNIP1; RPS29; KRAS; ARRB1;
Blocking Peptide:
For anti-ADH6 (ARP41789_T100-HRP) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837)
Datasheets/Manuals:
Printable datasheet for anti-ADH6 (ARP41789_T100-HRP) antibody
Sample Type Confirmation:

ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...