Search Antibody, Protein, and ELISA Kit Solutions

ADH6 Antibody - middle region (ARP41789_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41789_T100-FITC Conjugated

ARP41789_T100-HRP Conjugated

ARP41789_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Alcohol dehydrogenase 6 (class V)
NCBI Gene Id:
Protein Name:
ADH6 protein EMBL AAH39065.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100495 from Santa Cruz Biotechnology.
Description of Target:
ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADH6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADH6.
The immunogen is a synthetic peptide directed towards the middle region of human ADH6
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-ADH6 (ARP41789_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADH6 (ARP41789_T100) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837)
Printable datasheet for anti-ADH6 (ARP41789_T100) antibody
Sample Type Confirmation:

ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2


Cho, NE; Bang, BR; Gurung, P; Li, M; Clemens, DL; Underhill, TM; James, LP; Chase, JR; Saito, T; Retinoid regulation of antiviral innate immunity in hepatocytes. 63, 1783-95 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26638120

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...