Size:100 ul
$229.00
In Stock
SKU
ARP41789_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41789_T100-FITC Conjugated

ARP41789_T100-HRP Conjugated

ARP41789_T100-Biotin Conjugated

ADH6 Antibody - middle region (ARP41789_T100)

Catalog#: ARP41789_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100495 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADH6
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79%
Complete computational species homology data Anti-ADH6 (ARP41789_T100)
Peptide Sequence Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ADH6 (ARP41789_T100) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837)
Datasheets/Manuals Printable datasheet for anti-ADH6 (ARP41789_T100) antibody
Sample Type Confirmation

ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Publications

Cho, NE; Bang, BR; Gurung, P; Li, M; Clemens, DL; Underhill, TM; James, LP; Chase, JR; Saito, T; Retinoid regulation of antiviral innate immunity in hepatocytes. 63, 1783-95 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26638120

Gene Symbol ADH6
Official Gene Full Name Alcohol dehydrogenase 6 (class V)
Alias Symbols ADH-5
NCBI Gene Id 130
Protein Name ADH6 protein EMBL AAH39065.1
Description of Target ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
Swissprot Id Q8IUN7
Protein Accession # AAH39065
Nucleotide Accession # NM_000672
Protein Size (# AA) 295
Molecular Weight 32kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADH6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADH6.
Protein Interactions RPAIN; RASSF5; RSL1D1; ANKRD17; TNIP1; RPS29; KRAS; ARRB1;
  1. What is the species homology for "ADH6 Antibody - middle region (ARP41789_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ADH6 Antibody - middle region (ARP41789_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADH6 Antibody - middle region (ARP41789_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADH6 Antibody - middle region (ARP41789_T100)"?

    This target may also be called "ADH-5" in publications.

  5. What is the shipping cost for "ADH6 Antibody - middle region (ARP41789_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADH6 Antibody - middle region (ARP41789_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADH6 Antibody - middle region (ARP41789_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "32kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADH6 Antibody - middle region (ARP41789_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ADH6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADH6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADH6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADH6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADH6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADH6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADH6 Antibody - middle region (ARP41789_T100)
Your Rating