Search Antibody, Protein, and ELISA Kit Solutions

ADH6 antibody - middle region (ARP41789_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41789_T100-FITC Conjugated

ARP41789_T100-HRP Conjugated

ARP41789_T100-Biotin Conjugated

Gene Symbol:
ADH6
NCBI Gene Id:
130
Official Gene Full Name:
Alcohol dehydrogenase 6 (class V)
Protein Name:
ADH6 protein EMBL AAH39065.1
Swissprot Id:
Q8IUN7
Protein Accession #:
AAH39065
Nucleotide Accession #:
NM_000672
Alias Symbols:
ADH-5
Replacement Item:
This antibody may replace item sc-100495 from Santa Cruz Biotechnology.
Description of Target:
ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
Protein Size (# AA):
295
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADH6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADH6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ADH6
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-ADH6 (ARP41789_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RPAIN; RASSF5; RSL1D1; ANKRD17; TNIP1; RPS29; KRAS; ARRB1;
Blocking Peptide:
For anti-ADH6 (ARP41789_T100) antibody is Catalog # AAP41789 (Previous Catalog # AAPP10837)
Datasheets/Manuals:
Printable datasheet for anti-ADH6 (ARP41789_T100) antibody
Sample Type Confirmation:

ADH6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Publications:

Cho, NE; Bang, BR; Gurung, P; Li, M; Clemens, DL; Underhill, TM; James, LP; Chase, JR; Saito, T; Retinoid regulation of antiviral innate immunity in hepatocytes. 63, 1783-95 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26638120

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...