Size:100 ul
$229.00
In stock
SKU
ARP43573_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43573_T100-FITC Conjugated

ARP43573_T100-HRP Conjugated

ARP43573_T100-Biotin Conjugated

ADH4 Antibody - middle region (ARP43573_T100)

Catalog#: ARP43573_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105043 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADH4
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79%
Complete computational species homology data Anti-ADH4 (ARP43573_T100)
Peptide Sequence Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ADH4 (ARP43573_T100) antibody is Catalog # AAP43573 (Previous Catalog # AAPS13605)
Datasheets/Manuals Printable datasheet for anti-ADH4 (ARP43573_T100) antibody
Target Reference Luo,X., (2005) Pharmacogenet. Genomics 15 (11), 755-768
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Human, Pig, Rabbit, Rat 24465277

Gene Symbol ADH4
Official Gene Full Name Alcohol dehydrogenase 4 (class II), pi polypeptide
Alias Symbols ADH-2
NCBI Gene Id 127
Protein Name Alcohol dehydrogenase 4
Description of Target ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
Swissprot Id P08319
Protein Accession # NP_000661
Nucleotide Accession # NM_000670
Protein Size (# AA) 380
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADH4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADH4.
Protein Interactions UBC; RPL35; YWHAE; APP;
Write Your Own Review
You're reviewing:ADH4 Antibody - middle region (ARP43573_T100)
Your Rating