Search Antibody, Protein, and ELISA Kit Solutions

ADH4 Antibody - middle region (ARP43573_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43573_T100-FITC Conjugated

ARP43573_T100-HRP Conjugated

ARP43573_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Human, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Alcohol dehydrogenase 4 (class II), pi polypeptide
NCBI Gene Id:
Protein Name:
Alcohol dehydrogenase 4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-105043 from Santa Cruz Biotechnology.
Description of Target:
ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADH4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADH4.
The immunogen is a synthetic peptide directed towards the middle region of human ADH4
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79%
Complete computational species homology data:
Anti-ADH4 (ARP43573_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADH4 (ARP43573_T100) antibody is Catalog # AAP43573 (Previous Catalog # AAPS13605)
Printable datasheet for anti-ADH4 (ARP43573_T100) antibody
Target Reference:
Luo,X., (2005) Pharmacogenet. Genomics 15 (11), 755-768

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Human, Pig, Rabbit, Rat 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...