Search Antibody, Protein, and ELISA Kit Solutions

ADH4 Antibody - middle region (ARP43572_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43572_P050-FITC Conjugated

ARP43572_P050-HRP Conjugated

ARP43572_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Alcohol dehydrogenase 4 (class II), pi polypeptide
NCBI Gene Id:
Protein Name:
Alcohol dehydrogenase 4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-105043 from Santa Cruz Biotechnology.
Description of Target:
ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADH4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADH4.
The immunogen is a synthetic peptide directed towards the middle region of human ADH4
Predicted Species Reactivity:
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-ADH4 (ARP43572_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADH4 (ARP43572_P050) antibody is Catalog # AAP43572 (Previous Catalog # AAPP25017)
Printable datasheet for anti-ADH4 (ARP43572_P050) antibody
Additional Information:
IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Kuo,P.H., (2008) Alcohol. Clin. Exp. Res. 32 (5), 785-795

Cho, NE; Bang, BR; Gurung, P; Li, M; Clemens, DL; Underhill, TM; James, LP; Chase, JR; Saito, T; Retinoid regulation of antiviral innate immunity in hepatocytes. 63, 1783-95 (2016). IHC, WB, Human 26638120

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...