Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP43572_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43572_P050-FITC Conjugated

ARP43572_P050-HRP Conjugated

ARP43572_P050-Biotin Conjugated

ADH4 Antibody - middle region (ARP43572_P050)

Catalog#: ARP43572_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-105043 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ADH4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-ADH4 (ARP43572_P050)
Peptide SequenceSynthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ADH4 (ARP43572_P050) antibody is Catalog # AAP43572 (Previous Catalog # AAPP25017)
Datasheets/ManualsPrintable datasheet for anti-ADH4 (ARP43572_P050) antibody
Target ReferenceKuo,P.H., (2008) Alcohol. Clin. Exp. Res. 32 (5), 785-795
Publications

Cho, NE; Bang, BR; Gurung, P; Li, M; Clemens, DL; Underhill, TM; James, LP; Chase, JR; Saito, T; Retinoid regulation of antiviral innate immunity in hepatocytes. 63, 1783-95 (2016). IHC, WB, Human 26638120

Gene SymbolADH4
Official Gene Full NameAlcohol dehydrogenase 4 (class II), pi polypeptide
Alias SymbolsADH-2
NCBI Gene Id127
Protein NameAlcohol dehydrogenase 4
Description of TargetADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP08319
Protein Accession #NP_000661
Nucleotide Accession #NM_000670
Protein Size (# AA)380
Molecular Weight40kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ADH4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ADH4.
Protein InteractionsUBC; RPL35; YWHAE; APP;
Write Your Own Review
You're reviewing:ADH4 Antibody - middle region (ARP43572_P050)
Your Rating
Assay Development
Aviva Tips and Tricks
Aviva Validation Data
Aviva Live Chat