Search Antibody, Protein, and ELISA Kit Solutions

ADD3 antibody - middle region (ARP59947_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59947_P050-FITC Conjugated

ARP59947_P050-HRP Conjugated

ARP59947_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Adducin 3 (gamma)
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-118249 from Santa Cruz Biotechnology.
Description of Target:
Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADD3.
The immunogen is a synthetic peptide directed towards the middle region of human ADD3
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-ADD3 (ARP59947_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADD3 (ARP59947_P050) antibody is Catalog # AAP59947 (Previous Catalog # AAPP46110)
Printable datasheet for anti-ADD3 (ARP59947_P050) antibody
Sample Type Confirmation:

ADD3 is strongly supported by BioGPS gene expression data to be expressed in PANC1

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...