Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP52377_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP52377_P050-Biotin
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ADD2 (ARP52377_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen for Anti-ADD2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADDB
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: SAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLT
Concentration0.5 mg/ml
Blocking PeptideFor Anti-ADD2 antibody is Catalog # AAP52377
ReferenceN/A
Gene SymbolADD2
Gene Full Nameadducin 2 (beta)
Alias SymbolsADDB
NCBI Gene Id119
Description of TargetAdducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described.
Uniprot IDP35612
Protein Size (# AA)726
Molecular Weight79 kDa
  1. What is the species homology for "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)"?

    This target may also be called "ADDB" in publications.

  5. What is the shipping cost for "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "79 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADD2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADD2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADD2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADD2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADD2 Antibody - C-terminal region : Biotin (ARP52377_P050-Biotin)
Your Rating
We found other products you might like!