Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41916_P050-FITC Conjugated

ARP41916_P050-HRP Conjugated

ARP41916_P050-Biotin Conjugated

ADCYAP1 Antibody (ARP41916_P050)

Catalog#: ARP41916_P050
Domestic: within 1 week delivery | International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%
Complete computational species homology data Anti-ADCYAP1 (ARP41916_P050)
Peptide Sequence Synthetic peptide located within the following region: SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-ADCYAP1 (ARP41916_P050) antibody

Pituitary adenylate cyclase-activating polypeptide (PACAP) contributes to the proliferation of hematopoietic progenitor cells in murine bone marrow via PACAP-specific receptor. Sci Rep. 6, 22373 (2016). Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26925806

Gene Symbol ADCYAP1
Official Gene Full Name adenylate cyclase activating polypeptide 1 (pituitary)
Alias Symbols PACAP,
NCBI Gene Id 116
Protein Name Pituitary adenylate cyclase-activating polypeptide
Swissprot Id P18509
Protein Accession # NP_001108
Nucleotide Accession # NM_001099733
Protein Size (# AA) 176
Molecular Weight 19 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADCYAP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADCYAP1.
Protein Interactions VIPR2; SHH; CASP2; VIPR1; SCTR; MME; ADCYAP1R1; CPAMD8;
  1. What is the species homology for "ADCYAP1 Antibody (ARP41916_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "ADCYAP1 Antibody (ARP41916_P050)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "ADCYAP1 Antibody (ARP41916_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ADCYAP1 Antibody (ARP41916_P050)"?

    This target may also be called "PACAP, " in publications.

  5. What is the shipping cost for "ADCYAP1 Antibody (ARP41916_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADCYAP1 Antibody (ARP41916_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADCYAP1 Antibody (ARP41916_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADCYAP1 Antibody (ARP41916_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ADCYAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADCYAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADCYAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADCYAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADCYAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADCYAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADCYAP1 Antibody (ARP41916_P050)
Your Rating
We found other products you might like!