Size:100 ul
$125.00
In stock
SKU
ARP41916_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41916_P050-FITC Conjugated

ARP41916_P050-HRP Conjugated

ARP41916_P050-Biotin Conjugated

ADCYAP1 Antibody (ARP41916_P050)

Catalog#: ARP41916_P050
Domestic: within 1 week delivery International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%
Complete computational species homology data Anti-ADCYAP1 (ARP41916_P050)
Peptide Sequence Synthetic peptide located within the following region: SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-ADCYAP1 (ARP41916_P050) antibody
Publications

Pituitary adenylate cyclase-activating polypeptide (PACAP) contributes to the proliferation of hematopoietic progenitor cells in murine bone marrow via PACAP-specific receptor. Sci Rep. 6, 22373 (2016). Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26925806

Gene Symbol ADCYAP1
Official Gene Full Name adenylate cyclase activating polypeptide 1 (pituitary)
Alias Symbols PACAP,
NCBI Gene Id 116
Protein Name Pituitary adenylate cyclase-activating polypeptide
Swissprot Id P18509
Protein Accession # NP_001108
Nucleotide Accession # NM_001099733
Protein Size (# AA) 176
Molecular Weight 19 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADCYAP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADCYAP1.
Protein Interactions VIPR2; SHH; CASP2; VIPR1; SCTR; MME; ADCYAP1R1; CPAMD8;
Write Your Own Review
You're reviewing:ADCYAP1 Antibody (ARP41916_P050)
Your Rating