Search Antibody, Protein, and ELISA Kit Solutions

ADCYAP1 Antibody (ARP41916_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41916_P050-FITC Conjugated

ARP41916_P050-HRP Conjugated

ARP41916_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ADCYAP1
Official Gene Full Name:
adenylate cyclase activating polypeptide 1 (pituitary)
NCBI Gene Id:
116
Protein Name:
Pituitary adenylate cyclase-activating polypeptide
Swissprot Id:
P18509
Protein Accession #:
NP_001108
Nucleotide Accession #:
NM_001099733
Alias Symbols:
PACAP,
Protein Size (# AA):
176
Molecular Weight:
19 kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADCYAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADCYAP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%
Complete computational species homology data:
Anti-ADCYAP1 (ARP41916_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
VIPR2; SHH; CASP2; VIPR1; SCTR; MME; ADCYAP1R1; CPAMD8;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-ADCYAP1 (ARP41916_P050) antibody
Publications:

Pituitary adenylate cyclase-activating polypeptide (PACAP) contributes to the proliferation of hematopoietic progenitor cells in murine bone marrow via PACAP-specific receptor. Sci Rep. 6, 22373 (2016). Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26925806

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...