Search Antibody, Protein, and ELISA Kit Solutions

ADCK2 Antibody - middle region : FITC (ARP63131_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63131_P050 Unconjugated

ARP63131_P050-HRP Conjugated

ARP63131_P050-Biotin Conjugated

Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application:
IHC, WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
ADCK2
NCBI Gene Id:
90956
Protein Name:
Uncharacterized aarF domain-containing protein kinase 2
Swissprot Id:
Q7Z695
Protein Accession #:
NP_443085
Nucleotide Accession #:
NM_052853
Alias Symbols:
AARF, MGC20727
Replacement Item:
This antibody may replace item sc-130113 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
Protein Size (# AA):
626
Molecular Weight:
68kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADCK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADCK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-ADCK2 (ARP63131_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; YWHAQ;
Blocking Peptide:
For anti-ADCK2 (ARP63131_P050-FITC) antibody is Catalog # AAP63131
Datasheets/Manuals:
Printable datasheet for anti-ADCK2 (ARP63131_P050-FITC) antibody
Sample Type Confirmation:

ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...