Search Antibody, Protein, and ELISA Kit Solutions

ADCK2 Antibody - middle region (ARP63131_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63131_P050-FITC Conjugated

ARP63131_P050-HRP Conjugated

ARP63131_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Protein Name:
Uncharacterized aarF domain-containing protein kinase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AARF, MGC20727
Replacement Item:
This antibody may replace item sc-130113 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADCK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADCK2.
The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-ADCK2 (ARP63131_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADCK2 (ARP63131_P050) antibody is Catalog # AAP63131
Printable datasheet for anti-ADCK2 (ARP63131_P050) antibody
Sample Type Confirmation:

ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...