Search Antibody, Protein, and ELISA Kit Solutions

ADCK2 Antibody - middle region (ARP63131_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP63131_P050-FITC Conjugated

ARP63131_P050-HRP Conjugated

ARP63131_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130113 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-ADCK2 (ARP63131_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ADCK2 (ARP63131_P050) antibody is Catalog # AAP63131
Datasheets/Manuals:
Printable datasheet for anti-ADCK2 (ARP63131_P050) antibody
Sample Type Confirmation:

ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat

Gene Symbol:
ADCK2
Alias Symbols:
AARF, MGC20727
NCBI Gene Id:
90956
Protein Name:
Uncharacterized aarF domain-containing protein kinase 2
Description of Target:
The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
Swissprot Id:
Q7Z695
Protein Accession #:
NP_443085
Nucleotide Accession #:
NM_052853
Protein Size (# AA):
626
Molecular Weight:
68kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADCK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADCK2.
Protein Interactions:
UBC; YWHAQ;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...