Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ADCK2 Antibody - middle region (ARP63131_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP63131_P050-FITC Conjugated

ARP63131_P050-HRP Conjugated

ARP63131_P050-Biotin Conjugated

Gene Symbol:
ADCK2
NCBI Gene Id:
90956
Protein Name:
Uncharacterized aarF domain-containing protein kinase 2
Swissprot Id:
Q7Z695
Protein Accession #:
NP_443085
Nucleotide Accession #:
NM_052853
Alias Symbols:
AARF, MGC20727
Replacement Item:
This antibody may replace item sc-130113 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
Protein Size (# AA):
626
Molecular Weight:
68kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADCK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADCK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-ADCK2 (ARP63131_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; YWHAQ;
Blocking Peptide:
For anti-ADCK2 (ARP63131_P050) antibody is Catalog # AAP63131
Datasheets/Manuals:
Printable datasheet for anti-ADCK2 (ARP63131_P050) antibody
Sample Type Confirmation:

ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat

Tell us what you think about this item!

Write A Review
    Please, wait...