Search Antibody, Protein, and ELISA Kit Solutions

ADARB1 antibody - N-terminal region (ARP40342_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40342_T100-FITC Conjugated

ARP40342_T100-HRP Conjugated

ARP40342_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Adenosine deaminase, RNA-specific, B1
Protein Name:
Double-stranded RNA-specific editase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10010 from Santa Cruz Biotechnology.
Description of Target:
ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADARB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADARB1.
The immunogen is a synthetic peptide directed towards the N terminal region of human ADARB1
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 83%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-ADARB1 (ARP40342_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADARB1 (ARP40342_T100) antibody is Catalog # AAP40342 (Previous Catalog # AAPP10379)
Printable datasheet for anti-ADARB1 (ARP40342_T100) antibody
Target Reference:
Kawahara,Y., Gene 363, 193-201 (2005)

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23103828

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

206/07/2018 16:00
  • Quality:
  • Overall Experience:
Human PC3 cell line in WB

Submitted by:

Hua XU, M.D.

University of Rochester Medical Center



  1. Sample type/lane description: Human, PC3 cell line.

Lane 1: 40 ug PC3 cell lysate

Lane 2: 40 ug PC3 cell lysate

Lane 3: 40 ug PC3 cell lysate

Lane 4:40 ug PC3 cell lysate

2. Primary antibody dilution: 1:1000

3. Secondary antibody and dilution: 1:10000

4. Protocol:

Cells lysis were collected after half an hour on ice. Loading buffer was added to terminate the reaction.  Standard procedure of western blot was applied.

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...