Size:100 ul
$229.00
In stock
SKU
ARP40342_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40342_T100-FITC Conjugated

ARP40342_T100-HRP Conjugated

ARP40342_T100-Biotin Conjugated

ADARB1 Antibody - N-terminal region (ARP40342_T100)

Rating:
80% of 100
Catalog#: ARP40342_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10010 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ADARB1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 83%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-ADARB1 (ARP40342_T100)
Peptide Sequence Synthetic peptide located within the following region: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ADARB1 (ARP40342_T100) antibody is Catalog # AAP40342 (Previous Catalog # AAPP10379)
Datasheets/Manuals Printable datasheet for anti-ADARB1 (ARP40342_T100) antibody
Target Reference Kawahara,Y., Gene 363, 193-201 (2005)
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23103828

Gene Symbol ADARB1
Official Gene Full Name Adenosine deaminase, RNA-specific, B1
Alias Symbols RED1, ADAR2, DRABA2, DRADA2
NCBI Gene Id 104
Protein Name Double-stranded RNA-specific editase 1
Description of Target ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region.
Swissprot Id Q4AE79
Protein Accession # NP_001103
Nucleotide Accession # NM_001112
Protein Size (# AA) 701
Molecular Weight 77kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADARB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADARB1.
Protein Interactions EBNA1BP2; IFRD2; CCDC124; NIFK; C7orf50; C1orf35; STRBP; BRIX1; SDAD1; ZFR; NOP16; MRTO4; RRS1; BMI1; APP; UBC; PPP2CB; WWP2; PIN1;
Write Your Own Review
You're reviewing:ADARB1 Antibody - N-terminal region (ARP40342_T100)
Your Rating