ADAMTS4 Antibody - N-terminal region : HRP (ARP41556_P050-HRP)

Catalog No: ARP41556_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADAMTS4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADAMTS4 (ARP41556_P050-HRP) antibody is Catalog # AAP41556 (Previous Catalog # AAPP24241)
• Publications:

  Lee, C. W. et al. Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina. J. Clin. Pathol. 64, 399-404 (2011). IHC, Horse, Human, Rat, Pig, Bovine, Guinea pig, Mouse, Dog, Rabbit 21345877

  Boerboom, D. et al. Partially redundant functions of Adamts1 and Adamts4 in the perinatal development of the renal medulla. Dev. Dyn. 240, 1806-14 (2011). IHC, Horse, Human, Rat, Pig, Bovine, Guinea pig, Mouse, Dog, Rabbit 21584905

  Lee, S.-Y. et al. Differential expression patterns of a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) -1, -4, -5, and -14 in human placenta and gestational trophoblastic diseases. Arch. Pathol. Lab. Med. 138, 643-50 (2014). IHC, Horse, Human, Rat, Pig, Bovine, Guinea pig, Mouse, Dog, Rabbit 24786121

Target Info

• Gene Symbol: ADAMTS4
• Gene Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 4
• Alias Symbols: ADMP-1, ADAMTS-2, ADAMTS-4
• NCBI Gene Id: 9507
• Description of Target: ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
• Uniprot ID: Q8NEK2
• Protein Accession #: AAH30812
• Protein Size (# AA): 339
• Molecular Weight: 37kDa
• Protein Interactions: YTHDC1; ZBTB16; ELAVL1; UBC; MT2A; SRPX2; ADAMTS4; BCAN; SERPINA1; ACAN; HP; FURIN; FN1; SERPINA3;