Search Antibody, Protein, and ELISA Kit Solutions

ADAMTS4 Antibody - N-terminal region (ARP41556_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41556_P050-FITC Conjugated

ARP41556_P050-HRP Conjugated

ARP41556_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ADAMTS4
Official Gene Full Name:
ADAM metallopeptidase with thrombospondin type 1 motif, 4
NCBI Gene Id:
9507
Swissprot Id:
Q8NEK2
Protein Accession #:
AAH30812
Alias Symbols:
ADAMTS-2, ADAMTS-4, ADMP-1, KIAA0688
Replacement Item:
This antibody may replace item sc-16533 from Santa Cruz Biotechnology.
Description of Target:
ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
Protein Size (# AA):
339
Molecular Weight:
37kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADAMTS4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADAMTS4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAMTS4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-ADAMTS4 (ARP41556_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
YTHDC1; ZBTB16; ELAVL1; UBC; MT2A; SRPX2; ADAMTS4; BCAN; SERPINA1; ACAN; HP; FURIN; FN1; SERPINA3;
Blocking Peptide:
For anti-ADAMTS4 (ARP41556_P050) antibody is Catalog # AAP41556 (Previous Catalog # AAPP24241)
Datasheets/Manuals:
Printable datasheet for anti-ADAMTS4 (ARP41556_P050) antibody
Publications:

Boerboom, D. et al. Partially redundant functions of Adamts1 and Adamts4 in the perinatal development of the renal medulla. Dev. Dyn. 240, 1806-14 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21584905

Lee, C. W. et al. Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina. J. Clin. Pathol. 64, 399-404 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21345877

Lee, S.-Y. et al. Differential expression patterns of a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) -1, -4, -5, and -14 in human placenta and gestational trophoblastic diseases. Arch. Pathol. Lab. Med. 138, 643-50 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24786121

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...