Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41556_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41556_P050-FITC Conjugated

ARP41556_P050-HRP Conjugated

ARP41556_P050-Biotin Conjugated

ADAMTS4 Antibody - N-terminal region (ARP41556_P050)

Catalog#: ARP41556_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-16533 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ADAMTS4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-ADAMTS4 (ARP41556_P050)
Peptide Sequence Synthetic peptide located within the following region: GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ADAMTS4 (ARP41556_P050) antibody is Catalog # AAP41556 (Previous Catalog # AAPP24241)
Datasheets/Manuals Printable datasheet for anti-ADAMTS4 (ARP41556_P050) antibody
Publications

Boerboom, D. et al. Partially redundant functions of Adamts1 and Adamts4 in the perinatal development of the renal medulla. Dev. Dyn. 240, 1806-14 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21584905

Lee, C. W. et al. Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina. J. Clin. Pathol. 64, 399-404 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21345877

Lee, S.-Y. et al. Differential expression patterns of a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) -1, -4, -5, and -14 in human placenta and gestational trophoblastic diseases. Arch. Pathol. Lab. Med. 138, 643-50 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24786121

Gene Symbol ADAMTS4
Official Gene Full Name ADAM metallopeptidase with thrombospondin type 1 motif, 4
Alias Symbols ADAMTS-2, ADAMTS-4, ADMP-1, KIAA0688
NCBI Gene Id 9507
Description of Target ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
Swissprot Id Q8NEK2
Protein Accession # AAH30812
Protein Size (# AA) 339
Molecular Weight 37kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADAMTS4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADAMTS4.
Protein Interactions YTHDC1; ZBTB16; ELAVL1; UBC; MT2A; SRPX2; ADAMTS4; BCAN; SERPINA1; ACAN; HP; FURIN; FN1; SERPINA3;
  1. What is the species homology for "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)"?

    This target may also be called "ADAMTS-2, ADAMTS-4, ADMP-1, KIAA0688" in publications.

  5. What is the shipping cost for "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADAMTS4 Antibody - N-terminal region (ARP41556_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ADAMTS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADAMTS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADAMTS4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADAMTS4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADAMTS4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADAMTS4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADAMTS4 Antibody - N-terminal region (ARP41556_P050)
Your Rating
We found other products you might like!