Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP41556_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41556_P050-FITC Conjugated

ARP41556_P050-HRP Conjugated

ARP41556_P050-Biotin Conjugated

ADAMTS4 Antibody - N-terminal region (ARP41556_P050)

Catalog#: ARP41556_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-16533 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ADAMTS4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology dataAnti-ADAMTS4 (ARP41556_P050)
Peptide SequenceSynthetic peptide located within the following region: GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ADAMTS4 (ARP41556_P050) antibody is Catalog # AAP41556 (Previous Catalog # AAPP24241)
Datasheets/ManualsPrintable datasheet for anti-ADAMTS4 (ARP41556_P050) antibody
Publications

Boerboom, D. et al. Partially redundant functions of Adamts1 and Adamts4 in the perinatal development of the renal medulla. Dev. Dyn. 240, 1806-14 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21584905

Lee, C. W. et al. Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina. J. Clin. Pathol. 64, 399-404 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21345877

Lee, S.-Y. et al. Differential expression patterns of a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) -1, -4, -5, and -14 in human placenta and gestational trophoblastic diseases. Arch. Pathol. Lab. Med. 138, 643-50 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24786121

Gene SymbolADAMTS4
Official Gene Full NameADAM metallopeptidase with thrombospondin type 1 motif, 4
Alias SymbolsADAMTS-2, ADAMTS-4, ADMP-1, KIAA0688
NCBI Gene Id9507
Description of TargetADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
Swissprot IdQ8NEK2
Protein Accession #AAH30812
Protein Size (# AA)339
Molecular Weight37kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ADAMTS4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ADAMTS4.
Protein InteractionsYTHDC1; ZBTB16; ELAVL1; UBC; MT2A; SRPX2; ADAMTS4; BCAN; SERPINA1; ACAN; HP; FURIN; FN1; SERPINA3;
Write Your Own Review
You're reviewing:ADAMTS4 Antibody - N-terminal region (ARP41556_P050)
Your Rating
Aviva Validation Data
Aviva Travel Grant
Aviva Tissue Tool
Aviva Live Chat