Search Antibody, Protein, and ELISA Kit Solutions

ADAMTS13 Antibody (ARP60922_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60922_P050-FITC Conjugated

ARP60922_P050-HRP Conjugated

ARP60922_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ADAMTS13
Official Gene Full Name:
ADAM metallopeptidase with thrombospondin type 1 motif, 13
NCBI Gene Id:
11093
Protein Name:
A disintegrin and metalloproteinase with thrombospondin motifs 13
Swissprot Id:
Q76LX8
Protein Accession #:
NP_620594
Nucleotide Accession #:
NM_139025
Alias Symbols:
13, TTP, VWFCP, C9orf8, vWF-CP, ADAM-TS, ADAM-TS13, ADAMTS-13,
Description of Target:
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.
Protein Size (# AA):
1,427
Molecular Weight:
154 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADAMTS13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADAMTS13.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence YWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-ADAMTS13 (ARP60922_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
VWF;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-ADAMTS13 (ARP60922_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...