Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP46991_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46991_P050-FITC Conjugated

ARP46991_P050-HRP Conjugated

ARP46991_P050-Biotin Conjugated

Adam29 Antibody - N-terminal region (ARP46991_P050)

Catalog#: ARP46991_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-26018 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 86%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%
Complete computational species homology dataAnti-Adam29 (ARP46991_P050)
Peptide SequenceSynthetic peptide located within the following region: DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Adam29 (ARP46991_P050) antibody is Catalog # AAP46991
Datasheets/ManualsPrintable datasheet for anti-Adam29 (ARP46991_P050) antibody
Publications

Wang, G. et al. Mapping of the N-linked glycoproteome of human spermatozoa. J. Proteome Res. 12, 5750-9 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24191733

Gene SymbolAdam29
Official Gene Full NameA disintegrin and metallopeptidase domain 29
Alias Symbols-
NCBI Gene Id244486
Protein NameDisintegrin and metalloproteinase domain-containing protein 29
Description of TargetAdam29 may be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein.
Swissprot IdQ811Q4
Protein Accession #NP_787953
Nucleotide Accession #NM_175939
Protein Size (# AA)763
Molecular Weight86kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Adam29.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Adam29.
Write Your Own Review
You're reviewing:Adam29 Antibody - N-terminal region (ARP46991_P050)
Your Rating
Aviva HIS tag Deal
Aviva Live Chat
Aviva Tissue Tool
Aviva Blast Tool