Search Antibody, Protein, and ELISA Kit Solutions

Adam29 Antibody - N-terminal region (ARP46991_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46991_P050-FITC Conjugated

ARP46991_P050-HRP Conjugated

ARP46991_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
A disintegrin and metallopeptidase domain 29
NCBI Gene Id:
Protein Name:
Disintegrin and metalloproteinase domain-containing protein 29
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-26018 from Santa Cruz Biotechnology.
Description of Target:
Adam29 may be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Adam29.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Adam29.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 86%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%
Complete computational species homology data:
Anti-Adam29 (ARP46991_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Adam29 (ARP46991_P050) antibody is Catalog # AAP46991
Printable datasheet for anti-Adam29 (ARP46991_P050) antibody

Wang, G. et al. Mapping of the N-linked glycoproteome of human spermatozoa. J. Proteome Res. 12, 5750-9 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24191733

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...