Search Antibody, Protein, and ELISA Kit Solutions

ADAM23 Antibody - C-terminal region : FITC (ARP73735_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73735_P050 Unconjugated

ARP73735_P050-HRP Conjugated

ARP73735_P050-Biotin Conjugated

Gene Symbol:
ADAM23
NCBI Gene Id:
8745
Swissprot Id:
O75077
Protein Accession #:
XP_005246989
Alias Symbols:
ADAM23, MDC3,
Replacement Item:
This antibody may replace item sc-50482 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. It is reported that inactivation of this gene is associated with tumorigenesis in human cancers.
Protein Size (# AA):
832
Molecular Weight:
91kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADAM23.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADAM23.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADAM23
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
ELAVL1; PRNP;
Blocking Peptide:
For anti-ADAM23 (ARP73735_P050-FITC) antibody is Catalog # AAP73735
Datasheets/Manuals:
Printable datasheet for anti-ADAM23 (ARP73735_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...