Size:100 ul
$289.00
In Stock
SKU
ARP73735_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73735_P050 Unconjugated

ARP73735_P050-HRP Conjugated

ARP73735_P050-Biotin Conjugated

ADAM23 Antibody - C-terminal region : FITC (ARP73735_P050-FITC)

Catalog#: ARP73735_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-50482 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human ADAM23
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: DCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGF
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADAM23 (ARP73735_P050-FITC) antibody is Catalog # AAP73735
Datasheets/ManualsPrintable datasheet for anti-ADAM23 (ARP73735_P050-FITC) antibody
Gene SymbolADAM23
Alias SymbolsADAM23, MDC3,
NCBI Gene Id8745
Description of TargetThis gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. It is reported that inactivation of this gene is associated with tumorigenesis in human cancers.
Swissprot IdO75077
Protein Accession #XP_005246989
Protein Size (# AA)832
Molecular Weight91kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ADAM23.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ADAM23.
Protein InteractionsELAVL1; PRNP;
Write Your Own Review
You're reviewing:ADAM23 Antibody - C-terminal region : FITC (ARP73735_P050-FITC)
Your Rating
Aviva Pathways
Aviva Travel Grant
Aviva ChIP Antibodies
Aviva Tips and Tricks