Adam23 Antibody - C-terminal region (ARP46366_P050)

Catalog No: ARP46366_P050

WB Suggested Anti-Adam23 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Heart

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Adam23 (ARP46366_P050) antibody is Catalog # AAP46366 (Previous Catalog # AAPP27152)

Target Info

• Gene Symbol: Adam23
• Gene Full Name: A disintegrin and metallopeptidase domain 23
• Alias Symbols: MDC3, AW046396
• NCBI Gene Id: 23792
• Protein Name: Disintegrin and metalloproteinase domain-containing protein 23
• Description of Target: Adam23 may play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.
• Uniprot ID: Q9R1V7
• Protein Accession #: NP_035910
• Nucleotide Accession #: NM_011780
• Protein Size (# AA): 829
• Molecular Weight: 60kDa
• Protein Interactions: Prnp;