ADAM19 Antibody - N-terminal region : FITC (ARP49780_P050-FITC)

Catalog No: ARP49780_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM19
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADAM19 (ARP49780_P050-FITC) antibody is Catalog # AAP49780 (Previous Catalog # AAPS27503)
• Reference: Tanabe,C., (2007) Biochem. Biophys. Res. Commun. 352 (1), 111-117
• Publications:

  Marballi, K., Cruz, D., Thompson, P. & Walss-Bass, C. Differential neuregulin 1 cleavage in the prefrontal cortex and hippocampus in schizophrenia and bipolar disorder: preliminary findings. PLoS One 7, e36431 (2012). WB, IP, Human, Bovine, Dog, Pig, Horse, Rabbit, Guinea pig, Mouse, Rat, Zebrafish 22590542

Target Info

• Gene Symbol: ADAM19
• Gene Full Name: ADAM metallopeptidase domain 19
• Alias Symbols: MLTNB, FKSG34, MADDAM
• NCBI Gene Id: 8728
• Protein Name: Disintegrin and metalloproteinase domain-containing protein 19
• Description of Target: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
• Uniprot ID: Q9H013
• Protein Accession #: NP_075525
• Nucleotide Accession #: NM_023038
• Protein Size (# AA): 956
• Molecular Weight: 82kDa
• Protein Interactions: UBC; TNFSF11; COPB1; NRG1; FURIN; A2M; ABI2; SH3GL2; ESF1;