ADA Antibody - N-terminal region : HRP (ARP51757_P050-HRP)

Catalog No: ARP51757_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADA (ARP51757_P050-HRP) antibody is Catalog # AAP51757 (Previous Catalog # AAPP40132)
• Publications:

  Ferrante, A. et al. Expression, pharmacology and functional activity of adenosine A1 receptors in genetic models of Huntington’s disease. Neurobiol. Dis. 71C, 193-204 (2014). WB, Bovine, Human, Rabbit, Rat, Guinea pig, Mouse, Dog, Horse 25132555

Target Info

• Gene Symbol: ADA
• Gene Full Name: Adenosine deaminase
• Alias Symbols: ADA1
• NCBI Gene Id: 100
• Protein Name: Adenosine deaminase
• Description of Target: ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
• Uniprot ID: P00813
• Protein Accession #: NP_000013
• Nucleotide Accession #: NM_000022
• Protein Size (# AA): 363
• Molecular Weight: 41kDa
• Protein Interactions: UBC; SGCD; PIAS2; TERF2IP; TINF2; ADORA2B; DPP4; NR3C1; DRD1; GRB2; ADORA2A; ADORA1;