Search Antibody, Protein, and ELISA Kit Solutions

ADA Antibody - N-terminal region (ARP51757_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51757_P050-FITC Conjugated

ARP51757_P050-HRP Conjugated

ARP51757_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Adenosine deaminase
NCBI Gene Id:
Protein Name:
Adenosine deaminase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-158238 from Santa Cruz Biotechnology.
Description of Target:
ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADA.
The immunogen is a synthetic peptide directed towards the N terminal region of human ADA
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ADA (ARP51757_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADA (ARP51757_P050) antibody is Catalog # AAP51757 (Previous Catalog # AAPP40132)
Printable datasheet for anti-ADA (ARP51757_P050) antibody

Ferrante, A. et al. Expression, pharmacology and functional activity of adenosine A1 receptors in genetic models of Huntington’s disease. Neurobiol. Dis. 71C, 193-204 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 25132555

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...