Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP51757_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51757_P050-FITC Conjugated

ARP51757_P050-HRP Conjugated

ARP51757_P050-Biotin Conjugated

ADA Antibody - N-terminal region (ARP51757_P050)

Catalog#: ARP51757_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-158238 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ADA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-ADA (ARP51757_P050)
Peptide Sequence Synthetic peptide located within the following region: AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ADA (ARP51757_P050) antibody is Catalog # AAP51757 (Previous Catalog # AAPP40132)
Datasheets/Manuals Printable datasheet for anti-ADA (ARP51757_P050) antibody
Publications

Ferrante, A. et al. Expression, pharmacology and functional activity of adenosine A1 receptors in genetic models of Huntington’s disease. Neurobiol. Dis. 71C, 193-204 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 25132555

Gene Symbol ADA
Official Gene Full Name Adenosine deaminase
Alias Symbols -
NCBI Gene Id 100
Protein Name Adenosine deaminase
Description of Target ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
Swissprot Id P00813
Protein Accession # NP_000013
Nucleotide Accession # NM_000022
Protein Size (# AA) 363
Molecular Weight 41kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADA.
Protein Interactions UBC; SGCD; PIAS2; TERF2IP; TINF2; ADORA2B; DPP4; NR3C1; DRD1; GRB2; ADORA2A; ADORA1;
  1. What is the species homology for "ADA Antibody - N-terminal region (ARP51757_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ADA Antibody - N-terminal region (ARP51757_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADA Antibody - N-terminal region (ARP51757_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADA Antibody - N-terminal region (ARP51757_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "ADA Antibody - N-terminal region (ARP51757_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADA Antibody - N-terminal region (ARP51757_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADA Antibody - N-terminal region (ARP51757_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADA Antibody - N-terminal region (ARP51757_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ADA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADA Antibody - N-terminal region (ARP51757_P050)
Your Rating
We found other products you might like!