Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ACY1 Antibody - middle region : FITC (ARP75886_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75886_P050 Unconjugated

ARP75886_P050-HRP Conjugated

ARP75886_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ACY1
NCBI Gene Id:
95
Swissprot Id:
Q03154-4
Protein Accession #:
NP_001185827
Alias Symbols:
ACY1,
Description of Target:
This gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18.
Protein Size (# AA):
373
Molecular Weight:
41kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACY1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACY1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human ACY1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-ACY1 (ARP75886_P050-FITC) antibody is Catalog # AAP75886
Datasheets/Manuals:
Printable datasheet for anti-ACY1 (ARP75886_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...