- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for ACVRL1 Antibody (OAAL00005) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 5B1 |
Isotype | IgG1 Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | ACVRL1 |
---|---|
Gene Full Name | activin A receptor like type 1 |
Alias Symbols | activin A receptor type II-like 1;activin A receptor type IL;activin A receptor, type II-like kinase 1;ACVRLK1;ALK1;ALK-1;HHT;HHT2;ORW2;serine/threonine-protein kinase receptor R3;SKR3;TGF-B superfamily receptor type I;TSR-I. |
NCBI Gene Id | 94 |
Protein Name | Activin A receptor type II-like 1 [Homo sapiens]|Homo sapiens activin A receptor type II-like 1, mRNA (cDNA clone MGC:34522 IMAGE:5179243), complete cds |
Description of Target | This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH42637 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC042637 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ACVRL1 Antibody (OAAL00005)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "ACVRL1 Antibody (OAAL00005)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "ACVRL1 Antibody (OAAL00005)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ACVRL1 Antibody (OAAL00005)"?
This target may also be called "activin A receptor type II-like 1;activin A receptor type IL;activin A receptor, type II-like kinase 1;ACVRLK1;ALK1;ALK-1;HHT;HHT2;ORW2;serine/threonine-protein kinase receptor R3;SKR3;TGF-B superfamily receptor type I;TSR-I." in publications.
-
What is the shipping cost for "ACVRL1 Antibody (OAAL00005)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ACVRL1 Antibody (OAAL00005)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ACVRL1 Antibody (OAAL00005)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ACVRL1 Antibody (OAAL00005)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ACVRL1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ACVRL1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ACVRL1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ACVRL1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ACVRL1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ACVRL1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.