Size:100 ug
$299.00
In Stock
SKU
OAAF08008
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF08008-FITC Conjugated

OAAF08008-HRP Conjugated

OAAF08008-Biotin Conjugated

ACVRL1 Antibody (OAAF08008)

Catalog#: OAAF08008
Domestic: within 1 week delivery | International: 1 week
More Information
Predicted Species Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage Stable at -20C for at least 1 year.
Replacement Item This antibody may replace item sc-101555 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from the N-terminal region of human ACVRL1.
Purification The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide Sequence Synthetic peptide located within the following region: GDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG
Concentration 1mg/ml
Datasheets/Manuals Printable datasheet for OAAF08008
Specificity ACVRL1 Antibody detects endogenous levels of ACVRL1 protein.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info WB: 1:500~1:1000
ELISA: 1:10000
Gene Symbol ACVRL1
Alias Symbols ACVRL1, ACVRLK1, ALK1, Serine/threonine-protein kinase receptor R3, SKR3, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I
NCBI Gene Id 94
Swissprot Id P37023
Molecular Weight 56 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACVRL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACVRL1.
  1. What is the species homology for "ACVRL1 Antibody (OAAF08008)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "ACVRL1 Antibody (OAAF08008)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "ACVRL1 Antibody (OAAF08008)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACVRL1 Antibody (OAAF08008)"?

    This target may also be called "ACVRL1, ACVRLK1, ALK1, Serine/threonine-protein kinase receptor R3, SKR3, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I" in publications.

  5. What is the shipping cost for "ACVRL1 Antibody (OAAF08008)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACVRL1 Antibody (OAAF08008)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACVRL1 Antibody (OAAF08008)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACVRL1 Antibody (OAAF08008)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ACVRL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACVRL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACVRL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACVRL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACVRL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACVRL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACVRL1 Antibody (OAAF08008)
Your Rating
We found other products you might like!