Search Antibody, Protein, and ELISA Kit Solutions

ACVRL1 Antibody (OAAF08008)

100 ug
$299.00
In Stock
Request Bulk Order Quote

Conjugation Options

OAAF08008-FITC Conjugated

OAAF08008-HRP Conjugated

OAAF08008-Biotin Conjugated

Predicted Species Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Gene Symbol:
ACVRL1
NCBI Gene Id:
94
Swissprot Id:
P37023
Alias Symbols:
ACVRL1, ACVRLK1, ALK1, Serine/threonine-protein kinase receptor R3, SKR3, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I
Replacement Item:
This antibody may replace item sc-101555 from Santa Cruz Biotechnology.
Molecular Weight:
56 kDa
Purification:
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACVRL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACVRL1.
Immunogen:
The antiserum was produced against synthesized peptide derived from the N-terminal region of human ACVRL1.
Peptide Sequence:
Synthetic peptide located within the following region: GDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF08008
Specificity:
ACVRL1 Antibody detects endogenous levels of ACVRL1 protein.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
ELISA: 1:10000

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...