ACTRT2 Antibody - C-terminal region (ARP52502_P050)

Catalog No: ARP52502_P050

WB Suggested Anti-ACTRT2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACTRT2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACTRT2 (ARP52502_P050) antibody is Catalog # AAP52502 (Previous Catalog # AAPP30416)

Target Info

• Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718
• Gene Symbol: ACTRT2
• Gene Full Name: Actin-related protein T2
• Alias Symbols: ARPM2, ARPT2, Arp-T2, HARPM2
• NCBI Gene Id: 140625
• Protein Name: Actin-related protein T2
• Description of Target: ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.
• Uniprot ID: Q8TDY3
• Protein Accession #: NP_536356
• Nucleotide Accession #: NM_080431
• Protein Size (# AA): 377
• Molecular Weight: 42kDa