ACTR3B Antibody - N-terminal region : HRP (ARP57420_P050-HRP)

Catalog No: ARP57420_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACTR3B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACTR3B (ARP57420_P050-HRP) antibody is Catalog # AAP57420 (Previous Catalog # AAPP41419)

Target Info

• Gene Symbol: ACTR3B
• Gene Full Name: ARP3 actin-related protein 3 homolog B (yeast)
• Alias Symbols: ARP11, ARP3BETA
• NCBI Gene Id: 57180
• Protein Name: Actin-related protein 3B
• Description of Target: ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
• Uniprot ID: Q9P1U1
• Protein Accession #: NP_065178
• Nucleotide Accession #: NM_020445
• Protein Size (# AA): 418
• Molecular Weight: 47kDa
• Protein Interactions: PAN2; EXOC5; UBC; RSRC1; ARPC3P1; ARPC5L; CCAR2; TWF2; ARPC1A; ARPC2; ACTR2; ARPC1B; ARPC3; ARPC4; ARPC5; CDK4;