ACTR3B Antibody - N-terminal region (ARP57420_P050)

Catalog No: ARP57420_P050

WB Suggested Anti-ACTR3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACTR3B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACTR3B (ARP57420_P050) antibody is Catalog # AAP57420 (Previous Catalog # AAPP41419)
• Publications:

  Induced Arp2/3 Complex Depletion Increases FMNL2/3 Formin Expression and Filopodia Formation. Front Cell Dev Biol. 9, 634708 (2021)

• Description:
  View product citations for ACTR3B Antibody - N-terminal region (ARP57420_P050) on CiteAb

Target Info

• Gene Symbol: ACTR3B
• Gene Full Name: ARP3 actin-related protein 3 homolog B (yeast)
• Alias Symbols: ARP11, ARP3BETA
• NCBI Gene Id: 57180
• Protein Name: Actin-related protein 3B
• Description of Target: ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
• Uniprot ID: Q9P1U1
• Protein Accession #: NP_065178
• Nucleotide Accession #: NM_020445
• Protein Size (# AA): 418
• Molecular Weight: 47kDa
• Protein Interactions: PAN2; EXOC5; UBC; RSRC1; ARPC3P1; ARPC5L; CCAR2; TWF2; ARPC1A; ARPC2; ACTR2; ARPC1B; ARPC3; ARPC4; ARPC5; CDK4;