ACTR1A Antibody - middle region : HRP (ARP58414_P050-HRP)

Catalog No: ARP58414_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTR1A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACTR1A (ARP58414_P050-HRP) antibody is Catalog # AAP58414 (Previous Catalog # AAPP34545)

Target Info

• Reference: Sugarbaker,D.J., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3521-3526
• Gene Symbol: ACTR1A
• Gene Full Name: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
• Alias Symbols: ARP1, Arp1A, CTRN1
• NCBI Gene Id: 10121
• Protein Name: Alpha-centractin
• Description of Target: ACTR1A is a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P61163
• Protein Accession #: NP_005727
• Nucleotide Accession #: NM_005736
• Protein Size (# AA): 376
• Molecular Weight: 41kDa
• Protein Interactions: HUWE1; SUMO2; UBC; NUP133; DCTN4; MYCBP; DCTN3; DCTN2; ACTR1B; LMNB1; COG3; ACTR10; SMURF1; RRS1; PSMD1; PSMC4; MYH9; MCM7; COPS5; CUL1; CUL3; SUMO1; Cep76; Actr1a; Dctn1; Capza1; HDAC6; SPTBN2; SPTBN1; NUMA1; BICD2;