ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP58414_P050
Price: $0.00
SKU
ARP58414_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ACTR1A (ARP58414_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ACTR1A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACTR1A (ARP58414_P050) antibody is Catalog # AAP58414 (Previous Catalog # AAPP34545)
ReferenceSugarbaker,D.J., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3521-3526
Gene SymbolACTR1A
Gene Full NameARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
Alias SymbolsARP1, Arp1A, CTRN1
NCBI Gene Id10121
Protein NameAlpha-centractin
Description of TargetACTR1A is a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP61163
Protein Accession #NP_005727
Nucleotide Accession #NM_005736
Protein Size (# AA)376
Molecular Weight41kDa
Protein InteractionsHUWE1; SUMO2; UBC; NUP133; DCTN4; MYCBP; DCTN3; DCTN2; ACTR1B; LMNB1; COG3; ACTR10; SMURF1; RRS1; PSMD1; PSMC4; MYH9; MCM7; COPS5; CUL1; CUL3; SUMO1; Cep76; Actr1a; Dctn1; Capza1; HDAC6; SPTBN2; SPTBN1; NUMA1; BICD2;
  1. What is the species homology for "ACTR1A Antibody - middle region (ARP58414_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ACTR1A Antibody - middle region (ARP58414_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACTR1A Antibody - middle region (ARP58414_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACTR1A Antibody - middle region (ARP58414_P050)"?

    This target may also be called "ARP1, Arp1A, CTRN1" in publications.

  5. What is the shipping cost for "ACTR1A Antibody - middle region (ARP58414_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACTR1A Antibody - middle region (ARP58414_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACTR1A Antibody - middle region (ARP58414_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACTR1A Antibody - middle region (ARP58414_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACTR1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACTR1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACTR1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACTR1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACTR1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACTR1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACTR1A Antibody - middle region (ARP58414_P050)
Your Rating
We found other products you might like!