ACTR1A Antibody - middle region (ARP58414_P050)

Catalog No: ARP58414_P050

WB Suggested Anti-ACTR1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTR1A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACTR1A (ARP58414_P050) antibody is Catalog # AAP58414 (Previous Catalog # AAPP34545)
• Reference: Sugarbaker,D.J., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3521-3526

Target Info

• Gene Symbol: ACTR1A
• Gene Full Name: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
• Alias Symbols: ARP1, Arp1A, CTRN1
• NCBI Gene Id: 10121
• Protein Name: Alpha-centractin
• Description of Target: ACTR1A is a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P61163
• Protein Accession #: NP_005727
• Nucleotide Accession #: NM_005736
• Protein Size (# AA): 376
• Molecular Weight: 41kDa
• Protein Interactions: HUWE1; SUMO2; UBC; NUP133; DCTN4; MYCBP; DCTN3; DCTN2; ACTR1B; LMNB1; COG3; ACTR10; SMURF1; RRS1; PSMD1; PSMC4; MYH9; MCM7; COPS5; CUL1; CUL3; SUMO1; Cep76; Actr1a; Dctn1; Capza1; HDAC6; SPTBN2; SPTBN1; NUMA1; BICD2;