Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP42202_T100-FITC
Size:100ul
Price: $384.00
SKU
ARP42202_T100-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)

Datasheets/ManualsPrintable datasheet for anti-ACTN4 (ARP42202_T100-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ACTN4
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACTN4 (ARP42202_T100-FITC) antibody is Catalog # AAP42202 (Previous Catalog # AAPP24625)
Sample Type Confirmation

ACTN4 is supported by BioGPS gene expression data to be expressed in HCT116

ReferenceKimura,K., (2006) Genome Res. 16 (1), 55-65
Publications

Wei, S., Gao, X., Du, J., Su, J. & Xu, Z. Angiogenin enhances cell migration by regulating stress fiber assembly and focal adhesion dynamics. PLoS One 6, e28797 (2011). WB, Bovine, Human, Mouse, Dog, Pig, Horse, Rabbit, Rat, Guinea pig, Zebrafish 22194915

Gene SymbolACTN4
Gene Full NameActinin, alpha 4
Alias SymbolsFSGS, FSGS1, ACTININ-4
NCBI Gene Id81
Protein NameAlpha-actinin-4
Description of TargetAlpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis.
Uniprot IDO43707
Protein Accession #NP_004915
Nucleotide Accession #NM_004924
Protein Size (# AA)911
Molecular Weight100kDa
Protein InteractionsMYOZ2; HUWE1; UBC; BMP7; ACTN3; SUMO2; SUMO3; GNB2; SUMO1; NEDD8; MDM2; HGS; SF3A3; VCP; CDKN2A; ACTN1; PDLIM1; UBD; IGSF8; ICAM1; CD81; SVIL; Fcho2; POT1; VCAM1; TXN; RPS27; MAPK7; KPNA2; ITGA4; FN1; ESR1; CDH1; TRAF3IP1; FMNL1; NOS3; ACTN2; UBASH3B; SHC
  1. What is the species homology for "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)"?

    This target may also be called "FSGS, FSGS1, ACTININ-4" in publications.

  5. What is the shipping cost for "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "100kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACTN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACTN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACTN4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACTN4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACTN4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACTN4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACTN4 Antibody - N-terminal region : FITC (ARP42202_T100-FITC)
Your Rating
We found other products you might like!