Size:100 ul
$229.00
In Stock
SKU
ARP42202_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42202_T100-FITC Conjugated

ARP42202_T100-HRP Conjugated

ARP42202_T100-Biotin Conjugated

ACTN4 Antibody - N-terminal region (ARP42202_T100)

Rating:
100% of 100
Catalog#: ARP42202_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-134236 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN4
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-ACTN4 (ARP42202_T100)
Peptide Sequence Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACTN4 (ARP42202_T100) antibody is Catalog # AAP42202 (Previous Catalog # AAPP24625)
Datasheets/Manuals Printable datasheet for anti-ACTN4 (ARP42202_T100) antibody
Sample Type Confirmation

ACTN4 is supported by BioGPS gene expression data to be expressed in HCT116

Target Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Publications

Wei, S., Gao, X., Du, J., Su, J. & Xu, Z. Angiogenin enhances cell migration by regulating stress fiber assembly and focal adhesion dynamics. PLoS One 6, e28797 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22194915

Gene Symbol ACTN4
Official Gene Full Name Actinin, alpha 4
Alias Symbols DKFZp686K23158, FSGS, FSGS1, ACTININ-4
NCBI Gene Id 81
Protein Name Alpha-actinin-4
Description of Target Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis.
Swissprot Id O43707
Protein Accession # NP_004915
Nucleotide Accession # NM_004924
Protein Size (# AA) 911
Molecular Weight 100kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACTN4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACTN4.
Protein Interactions MYOZ2; HUWE1; UBC; BMP7; ACTN3; SUMO2; SUMO3; GNB2; SUMO1; NEDD8; MDM2; HGS; SF3A3; VCP; CDKN2A; ACTN1; PDLIM1; UBD; IGSF8; ICAM1; CD81; SVIL; Fcho2; POT1; VCAM1; TXN; RPS27; MAPK7; KPNA2; ITGA4; FN1; ESR1; CDH1; TRAF3IP1; FMNL1; NOS3; ACTN2; UBASH3B; SHC
  1. What is the species homology for "ACTN4 Antibody - N-terminal region (ARP42202_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ACTN4 Antibody - N-terminal region (ARP42202_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACTN4 Antibody - N-terminal region (ARP42202_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACTN4 Antibody - N-terminal region (ARP42202_T100)"?

    This target may also be called "DKFZp686K23158, FSGS, FSGS1, ACTININ-4" in publications.

  5. What is the shipping cost for "ACTN4 Antibody - N-terminal region (ARP42202_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACTN4 Antibody - N-terminal region (ARP42202_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACTN4 Antibody - N-terminal region (ARP42202_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "100kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACTN4 Antibody - N-terminal region (ARP42202_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ACTN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACTN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACTN4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACTN4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACTN4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACTN4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACTN4 Antibody - N-terminal region (ARP42202_T100)
Your Rating
We found other products you might like!