Search Antibody, Protein, and ELISA Kit Solutions

ACTN2 antibody - N-terminal region (ARP41462_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41462_P050-FITC Conjugated

ARP41462_P050-HRP Conjugated

ARP41462_P050-Biotin Conjugated

Gene Symbol:
ACTN2
NCBI Gene Id:
88
Official Gene Full Name:
Actinin, alpha 2
Protein Name:
Alpha-actinin-2
Swissprot Id:
P35609
Protein Accession #:
NP_001094
Nucleotide Accession #:
NM_001103
Alias Symbols:
CMD1AA
Replacement Item:
This antibody may replace item sc-116257 from Santa Cruz Biotechnology.
Description of Target:
The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-39 DC378038.1 17-55 40-2961 BC051770.1 1-2922 2962-3458 CB153006.1 65-561 3459-3637 AL359185.25 28531-28709 3638-4210 M86406.1 3609-4181 4211-4528 AL359185.25 29283-29600
Protein Size (# AA):
894
Molecular Weight:
104kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACTN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACTN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ACTN2 (ARP41462_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ACTN2; FAM154A; BRMS1L; MICALL2; MYOZ2; PDLIM3; SP100; SNAI1; MOS; RTP5; SYNPO2; SUMO1; IGSF8; ERBB2IP; CAPN1; ZNF446; RPL35; UBC; NOS3; ACTN1; ACTN4; FBXL22; COIL; SUMO3; ATXN2; KCNA5; LDB3; KCNN2; PSMA3; ITGB3BP; SNW1; MED14; NR1I2; KAT2B; NRIP1; ATXN7;
Blocking Peptide:
For anti-ACTN2 (ARP41462_P050) antibody is Catalog # AAP41462 (Previous Catalog # AAPS09208)
Datasheets/Manuals:
Printable datasheet for anti-ACTN2 (ARP41462_P050) antibody
Target Reference:
Bos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134
Publications:

Yan, Z. et al. BAF250B-associated SWI/SNF chromatin-remodeling complex is required to maintain undifferentiated mouse embryonic stem cells. Stem Cells 26, 1155-65 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18323406

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...