Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP41462_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41462_P050-FITC Conjugated

ARP41462_P050-HRP Conjugated

ARP41462_P050-Biotin Conjugated

ACTN2 Antibody - N-terminal region (ARP41462_P050)

Catalog#: ARP41462_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-116257 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-ACTN2 (ARP41462_P050)
Peptide Sequence Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACTN2 (ARP41462_P050) antibody is Catalog # AAP41462 (Previous Catalog # AAPS09208)
Datasheets/Manuals Printable datasheet for anti-ACTN2 (ARP41462_P050) antibody
Target Reference Bos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134
Publications

Yan, Z. et al. BAF250B-associated SWI/SNF chromatin-remodeling complex is required to maintain undifferentiated mouse embryonic stem cells. Stem Cells 26, 1155-65 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18323406

Gene Symbol ACTN2
Official Gene Full Name Actinin, alpha 2
Alias Symbols CMD1AA
NCBI Gene Id 88
Protein Name Alpha-actinin-2
Description of Target The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-39 DC378038.1 17-55 40-2961 BC051770.1 1-2922 2962-3458 CB153006.1 65-561 3459-3637 AL359185.25 28531-28709 3638-4210 M86406.1 3609-4181 4211-4528 AL359185.25 29283-29600
Swissprot Id P35609
Protein Accession # NP_001094
Nucleotide Accession # NM_001103
Protein Size (# AA) 894
Molecular Weight 104kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACTN2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACTN2.
Protein Interactions ACTN2; FAM154A; BRMS1L; MICALL2; MYOZ2; PDLIM3; SP100; SNAI1; MOS; RTP5; SYNPO2; SUMO1; IGSF8; ERBB2IP; CAPN1; ZNF446; RPL35; UBC; NOS3; ACTN1; ACTN4; FBXL22; COIL; SUMO3; ATXN2; KCNA5; LDB3; KCNN2; PSMA3; ITGB3BP; SNW1; MED14; NR1I2; KAT2B; NRIP1; ATXN7;
Write Your Own Review
You're reviewing:ACTN2 Antibody - N-terminal region (ARP41462_P050)
Your Rating