ACTL7B Antibody - middle region (ARP53662_P050)

Catalog No: ARP53662_P050

WB Suggested Anti-ACTL7B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTL7B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 83%; Human: 100%; Mouse: 85%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACTL7B (ARP53662_P050) antibody is Catalog # AAP53662 (Previous Catalog # AAPP30504)
• Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Target Info

• Gene Symbol: ACTL7B
• Gene Full Name: Actin-like 7B
• Alias Symbols: Tact1
• NCBI Gene Id: 10880
• Protein Name: Actin-like protein 7B
• Description of Target: ACTL7B is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.
• Uniprot ID: Q9Y614
• Protein Accession #: NP_006677
• Nucleotide Accession #: NM_006686
• Protein Size (# AA): 416
• Molecular Weight: 46kDa
• Protein Interactions: APP;