ACTL6B Antibody - middle region (ARP56847_P050)

Catalog No: ARP56847_P050

WB Suggested Anti-ACTL6B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTL6B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACTL6B (ARP56847_P050) antibody is Catalog # AAP56847 (Previous Catalog # AAPP39804)
• Reference: Oma,Y., (2003) Biochem. Biophys. Res. Commun. 301 (2), 521-528

Target Info

• Gene Symbol: ACTL6B
• Gene Full Name: Actin-like 6B
• Alias Symbols: ACTL6, DEE76, BAF53B, EIEE76, IDDSSAD, arpNalpha
• NCBI Gene Id: 51412
• Protein Name: Actin-like protein 6B
• Description of Target: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feat
• Uniprot ID: O94805
• Protein Accession #: NP_057272
• Nucleotide Accession #: NM_016188
• Protein Size (# AA): 426
• Molecular Weight: 47kDa
• Protein Interactions: UBC; APP; TK1; SMN1; PLK1; GSK3B; CSNK2B; CDKN1A; ANXA7; COQ9; CTBP1; SMARCA2;