Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40174_P050-FITC Conjugated

ARP40174_P050-HRP Conjugated

ARP40174_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10731 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human ACTB
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data Anti-ACTB (ARP40174_P050)
Peptide Sequence Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACTB (ARP40174_P050) antibody is Catalog # AAP40174
Datasheets/Manuals Printable datasheet for anti-ACTB (ARP40174_P050) antibody
Sample Type Confirmation

ACTB is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2, Jurkat, MCF7


Phungphong, S; Kijtawornrat, A; Wattanapermpool, J; Bupha-Intr, T; Regular exercise modulates cardiac mast cell activation in ovariectomized rats. 66, 165-73 (2016). IHC, WB, Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 26467449

Gene Symbol ACTB
Official Gene Full Name Actin, beta
Alias Symbols BRWS1, PS1TP5BP1
NCBI Gene Id 60
Protein Name Actin, cytoplasmic 1
Description of Target This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Swissprot Id P60709
Protein Accession # NP_001092
Nucleotide Accession # NM_001101
Protein Size (# AA) 375
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACTB.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACTB.
  1. What is the species homology for "ACTB Antibody - middle region (ARP40174_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "ACTB Antibody - middle region (ARP40174_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACTB Antibody - middle region (ARP40174_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ACTB Antibody - middle region (ARP40174_P050)"?

    This target may also be called "BRWS1, PS1TP5BP1" in publications.

  5. What is the shipping cost for "ACTB Antibody - middle region (ARP40174_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACTB Antibody - middle region (ARP40174_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACTB Antibody - middle region (ARP40174_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACTB Antibody - middle region (ARP40174_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ACTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACTB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACTB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACTB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACTB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACTB Antibody - middle region (ARP40174_P050)
Your Rating
We found other products you might like!