Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP40174_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40174_P050-FITC Conjugated

ARP40174_P050-HRP Conjugated

ARP40174_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-10731 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human ACTB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-ACTB (ARP40174_P050)
Peptide SequenceSynthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ACTB (ARP40174_P050) antibody is Catalog # AAP40174
Datasheets/ManualsPrintable datasheet for anti-ACTB (ARP40174_P050) antibody
Sample Type Confirmation

ACTB is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2, Jurkat, MCF7

Publications

Phungphong, S; Kijtawornrat, A; Wattanapermpool, J; Bupha-Intr, T; Regular exercise modulates cardiac mast cell activation in ovariectomized rats. 66, 165-73 (2016). IHC, WB, Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 26467449

Gene SymbolACTB
Official Gene Full NameActin, beta
Alias SymbolsBRWS1, PS1TP5BP1
NCBI Gene Id60
Protein NameActin, cytoplasmic 1
Description of TargetThis protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Swissprot IdP60709
Protein Accession #NP_001092
Nucleotide Accession #NM_001101
Protein Size (# AA)375
Molecular Weight42kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ACTB.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ACTB.
Protein InteractionsFUS; DSTN; CAP2; CFL2; CFL1; ACTG1; ACTB; PA2G4; EHHADH; WDYHV1; HDAC6; ISG15; TP53; CEP250; TUBGCP2; TUBGCP3; VCP; UBC; TUBG1; SUMO2; LGALS3BP; AMOT; NEDD1; HAUS1; IVNS1ABP; STAU1; MDM2; CORO7; LGR4; ASB12; ASB9; ZBTB1; ERG; RPA3; RPA2; RPA1; CDKN2A; PAR
Write Your Own Review
You're reviewing:ACTB Antibody - middle region (ARP40174_P050)
Your Rating
Aviva Travel Grant
Aviva Blast Tool
Aviva Live Chat
Aviva ChIP Antibodies