Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ACTB Antibody - middle region (ARP40174_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40174_P050-FITC Conjugated

ARP40174_P050-HRP Conjugated

ARP40174_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Actin, beta
NCBI Gene Id:
Protein Name:
Actin, cytoplasmic 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10731 from Santa Cruz Biotechnology.
Description of Target:
This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACTB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACTB.
The immunogen is a synthetic peptide directed towards the middle region of Human ACTB
Predicted Species Reactivity:
Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ACTB (ARP40174_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ACTB (ARP40174_P050) antibody is Catalog # AAP40174
Printable datasheet for anti-ACTB (ARP40174_P050) antibody
Sample Type Confirmation:

ACTB is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2, Jurkat, MCF7

Additional Information:
IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

Phungphong, S; Kijtawornrat, A; Wattanapermpool, J; Bupha-Intr, T; Regular exercise modulates cardiac mast cell activation in ovariectomized rats. 66, 165-73 (2016). IHC, WB, Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 26467449

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...