Acsl4 Antibody - C-terminal region (ARP49775_P050)

Catalog No: ARP49775_P050

Host: Rabbit
Target Name: Acsl4
Sample Type: Mouse Thymus lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Acsl4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Acsl4 (ARP49775_P050) antibody is Catalog # AAP49775

Target Info

• Gene Symbol: Acsl4
• Alias Symbols: AC, La, Fac, ACS4, Facl4, Lacs4, AU018108, 9430020A05Rik
• NCBI Gene Id: 50790
• Protein Name: Long-chain-fatty-acid--CoA ligase 4
• Description of Target: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses arachidonate and eicosapentaenoate as substrates.
• Uniprot ID: Q9QUJ7
• Protein Accession #: NP_997508
• Nucleotide Accession #: NM_207625
• Protein Size (# AA): 711
• Molecular Weight: 79kDa
• Protein Interactions: Eed; Foxp3;