Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ACSL1 antibody - C-terminal region (ARP32784_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP32784_P050-FITC Conjugated

ARP32784_P050-HRP Conjugated

ARP32784_P050-Biotin Conjugated

Gene Symbol:
ACSL1
NCBI Gene Id:
2180
Official Gene Full Name:
Acyl-CoA synthetase long-chain family member 1
Protein Name:
Long-chain-fatty-acid--CoA ligase 1
Swissprot Id:
P33121
Protein Accession #:
NP_001986
Nucleotide Accession #:
NM_001995
Alias Symbols:
ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Replacement Item:
This antibody may replace item sc-293281 from Santa Cruz Biotechnology.
Description of Target:
ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
698
Molecular Weight:
78kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACSL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACSL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ACSL1 (ARP32784_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; PARK2; ATP4A; UBC; NR3C2; ECT2; UBD;
Blocking Peptide:
For anti-ACSL1 (ARP32784_P050) antibody is Catalog # AAP32784 (Previous Catalog # AAPP03803)
Datasheets/Manuals:
Printable datasheet for anti-ACSL1 (ARP32784_P050) antibody
Sample Type Confirmation:

ACSL1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Additional Information:
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Ghosh,B., et al., (1995) Mol. Cell. Biochem. 151 (1), 77-81
Publications:

Golej, D. L. et al. Long-chain acyl-CoA synthetase 4 modulates prostaglandin E₂ release from human arterial smooth muscle cells. J. Lipid Res. 52, 782-93 (2011). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 21242590

Tell us what you think about this item!

Write A Review
    Please, wait...