Loading...
Catalog No: ARP32784_P050
Price: $0.00
SKU
ARP32784_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ACSL1 (ARP32784_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Additional InformationIHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACSL1 (ARP32784_P050) antibody is Catalog # AAP32784 (Previous Catalog # AAPP03803)
Sample Type Confirmation

ACSL1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

ReferenceGhosh,B., et al., (1995) Mol. Cell. Biochem. 151 (1), 77-81
Publications

Golej, D. L. et al. Long-chain acyl-CoA synthetase 4 modulates prostaglandin Eâ‚‚ release from human arterial smooth muscle cells. J. Lipid Res. 52, 782-93 (2011). 21242590

Gene SymbolACSL1
Gene Full NameAcyl-CoA synthetase long-chain family member 1
Alias SymbolsACS1, LACS, FACL1, FACL2, LACS1, LACS2
NCBI Gene Id2180
Protein NameLong-chain-fatty-acid--CoA ligase 1
Description of TargetACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP33121
Protein Accession #NP_001986
Nucleotide Accession #NM_001995
Protein Size (# AA)698
Molecular Weight78kDa
Protein InteractionsSUMO2; PARK2; ATP4A; UBC; NR3C2; ECT2; UBD;
  1. What is the species homology for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACSL1 Antibody - C-terminal region (ARP32784_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    This target may also be called "ACS1, LACS, FACL1, FACL2, LACS1, LACS2" in publications.

  5. What is the shipping cost for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "78kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACSL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACSL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACSL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACSL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACSL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACSL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACSL1 Antibody - C-terminal region (ARP32784_P050)
Your Rating
We found other products you might like!