Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP32784_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32784_P050-FITC Conjugated

ARP32784_P050-HRP Conjugated

ARP32784_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Additional Information IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-293281 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-ACSL1 (ARP32784_P050)
Peptide Sequence Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACSL1 (ARP32784_P050) antibody is Catalog # AAP32784 (Previous Catalog # AAPP03803)
Datasheets/Manuals Printable datasheet for anti-ACSL1 (ARP32784_P050) antibody
Sample Type Confirmation

ACSL1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference Ghosh,B., et al., (1995) Mol. Cell. Biochem. 151 (1), 77-81
Publications

Golej, D. L. et al. Long-chain acyl-CoA synthetase 4 modulates prostaglandin Eâ‚‚ release from human arterial smooth muscle cells. J. Lipid Res. 52, 782-93 (2011). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 21242590

Gene Symbol ACSL1
Official Gene Full Name Acyl-CoA synthetase long-chain family member 1
Alias Symbols ACS1, FACL1, FACL2, LACS, LACS1, LACS2
NCBI Gene Id 2180
Protein Name Long-chain-fatty-acid--CoA ligase 1
Description of Target ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P33121
Protein Accession # NP_001986
Nucleotide Accession # NM_001995
Protein Size (# AA) 698
Molecular Weight 78kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACSL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACSL1.
Protein Interactions SUMO2; PARK2; ATP4A; UBC; NR3C2; ECT2; UBD;
  1. What is the species homology for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACSL1 Antibody - C-terminal region (ARP32784_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    This target may also be called "ACS1, FACL1, FACL2, LACS, LACS1, LACS2" in publications.

  5. What is the shipping cost for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "78kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACSL1 Antibody - C-terminal region (ARP32784_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ACSL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACSL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACSL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACSL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACSL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACSL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACSL1 Antibody - C-terminal region (ARP32784_P050)
Your Rating
We found other products you might like!