Search Antibody, Protein, and ELISA Kit Solutions

ACSL1 Antibody - C-terminal region (ARP32784_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32784_P050-FITC Conjugated

ARP32784_P050-HRP Conjugated

ARP32784_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Acyl-CoA synthetase long-chain family member 1
NCBI Gene Id:
Protein Name:
Long-chain-fatty-acid--CoA ligase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-293281 from Santa Cruz Biotechnology.
Description of Target:
ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACSL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACSL1.
The immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ACSL1 (ARP32784_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ACSL1 (ARP32784_P050) antibody is Catalog # AAP32784 (Previous Catalog # AAPP03803)
Printable datasheet for anti-ACSL1 (ARP32784_P050) antibody
Sample Type Confirmation:

ACSL1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Ghosh,B., et al., (1995) Mol. Cell. Biochem. 151 (1), 77-81

Golej, D. L. et al. Long-chain acyl-CoA synthetase 4 modulates prostaglandin Eâ‚‚ release from human arterial smooth muscle cells. J. Lipid Res. 52, 782-93 (2011). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 21242590

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...