Catalog No: ARP53793_P050
Price: $0.00
SKU
ARP53793_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ACSBG2 Antibody - middle region (ARP53793_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ACSBG2 (ARP53793_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ACSBG2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 85%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACSBG2 (ARP53793_P050) antibody is Catalog # AAP53793 (Previous Catalog # AAPP30635)
Gene SymbolACSBG2
Gene Full NameAcyl-CoA synthetase bubblegum family member 2
Alias SymbolsBGR, BRGL, PRTDNY3, PRTD-NY3
NCBI Gene Id81616
Protein NameLong-chain-fatty-acid--CoA ligase ACSBG2
Description of TargetACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.
Uniprot IDQ5FVE4
Protein Accession #AAQ89126
Nucleotide Accession #Q5FVE4
Protein Size (# AA)616
Molecular Weight68kDa
Protein InteractionsCOPS5;
  1. What is the species homology for "ACSBG2 Antibody - middle region (ARP53793_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ACSBG2 Antibody - middle region (ARP53793_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACSBG2 Antibody - middle region (ARP53793_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACSBG2 Antibody - middle region (ARP53793_P050)"?

    This target may also be called "BGR, BRGL, PRTDNY3, PRTD-NY3" in publications.

  5. What is the shipping cost for "ACSBG2 Antibody - middle region (ARP53793_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACSBG2 Antibody - middle region (ARP53793_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACSBG2 Antibody - middle region (ARP53793_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACSBG2 Antibody - middle region (ARP53793_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACSBG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACSBG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACSBG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACSBG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACSBG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACSBG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACSBG2 Antibody - middle region (ARP53793_P050)
Your Rating