Catalog No: ARP53590_P050
Price: $0.00
SKU
ARP53590_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ACRV1 (ARP53590_P050) antibody
Product Info
ReferenceReddi,P.P., J. Reprod. Immunol. 53 (1-2), 25-36 (2002)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ACRV1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 79%; Human: 100%; Rabbit: 85%
Peptide SequenceSynthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACRV1 (ARP53590_P050) antibody is Catalog # AAP53590 (Previous Catalog # AAPP31111)
Gene SymbolACRV1
Gene Full NameAcrosomal vesicle protein 1
Alias SymbolsSP-10, SPACA2, D11S4365
NCBI Gene Id56
Protein NameAcrosomal protein SP-10
Description of TargetACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.
Uniprot IDP26436
Protein Accession #NP_001603
Nucleotide Accession #NM_001612
Protein Size (# AA)265
Molecular Weight29kDa
  1. What is the species homology for "ACRV1 Antibody - N-terminal region (ARP53590_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Guinea Pig, Rabbit".

  2. How long will it take to receive "ACRV1 Antibody - N-terminal region (ARP53590_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACRV1 Antibody - N-terminal region (ARP53590_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACRV1 Antibody - N-terminal region (ARP53590_P050)"?

    This target may also be called "SP-10, SPACA2, D11S4365" in publications.

  5. What is the shipping cost for "ACRV1 Antibody - N-terminal region (ARP53590_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACRV1 Antibody - N-terminal region (ARP53590_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACRV1 Antibody - N-terminal region (ARP53590_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACRV1 Antibody - N-terminal region (ARP53590_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACRV1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACRV1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACRV1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACRV1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACRV1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACRV1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACRV1 Antibody - N-terminal region (ARP53590_P050)
Your Rating
We found other products you might like!