ACRV1 Antibody - N-terminal region (ARP53590_P050)

Catalog No: ARP53590_P050

WB Suggested Anti-ACRV1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACRV1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 79%; Human: 100%; Rabbit: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACRV1 (ARP53590_P050) antibody is Catalog # AAP53590 (Previous Catalog # AAPP31111)

Target Info

• Reference: Reddi,P.P., J. Reprod. Immunol. 53 (1-2), 25-36 (2002)
• Gene Symbol: ACRV1
• Gene Full Name: Acrosomal vesicle protein 1
• Alias Symbols: SP-10, SPACA2, D11S4365
• NCBI Gene Id: 56
• Protein Name: Acrosomal protein SP-10
• Description of Target: ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.
• Uniprot ID: P26436
• Protein Accession #: NP_001603
• Nucleotide Accession #: NM_001612
• Protein Size (# AA): 265
• Molecular Weight: 29kDa