ACOT11 Antibody - middle region (ARP55280_P050)

Catalog No: ARP55280_P050

WB Suggested Anti-ACOT11 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateACOT11 is supported by BioGPS gene expression data to be expressed in HepG2

Rabbit Anti-ACOT11 antibody
Catalog Number: ARP55280
Formalin Fixed Paraffin Embedded Tissue: Human Adult Heart
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACOT11
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACOT11 (ARP55280_P050) antibody is Catalog # AAP55280 (Previous Catalog # AAPP33111)
• Sample Type Confirmation:

  ACOT11 is supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Gene Symbol: ACOT11
• Gene Full Name: Acyl-CoA thioesterase 11
• Alias Symbols: BFIT, THEA, THEM1, STARD14
• NCBI Gene Id: 26027
• Protein Name: Acyl-coenzyme A thioesterase 11
• Description of Target: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.
• Uniprot ID: D3DQ50
• Protein Accession #: NP_671517
• Nucleotide Accession #: NM_147161
• Protein Size (# AA): 594
• Molecular Weight: 65
• Protein Interactions: ACOT11;