Search Antibody, Protein, and ELISA Kit Solutions

ACO2 Antibody - N-terminal region (ARP56301_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56301_P050-FITC Conjugated

ARP56301_P050-HRP Conjugated

ARP56301_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130677 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human ACO2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%
Complete computational species homology data:
Anti-ACO2 (ARP56301_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ACO2 (ARP56301_P050) antibody is Catalog # AAP56301 (Previous Catalog # AAPP34417)
Printable datasheet for anti-ACO2 (ARP56301_P050) antibody
Sample Type Confirmation:

ACO2 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Yu,Z., (2006) Prostate 66 (10), 1061-1069

Freund, D. M., Prenni, J. E. & Curthoys, N. P. Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis. Am. J. Physiol. Renal Physiol. 304, F145-55 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast 23136003

Schauer, K. L., Freund, D. M., Prenni, J. E. & Curthoys, N. P. Proteomic profiling and pathway analysis of the response of rat renal proximal convoluted tubules to metabolic acidosis. Am. J. Physiol. Renal Physiol. 305, F628-40 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast 23804448

Gene Symbol:
Official Gene Full Name:
Aconitase 2, mitochondrial
Alias Symbols:
ACONM, MGC20605, MGC33908
NCBI Gene Id:
Protein Name:
Aconitate hydratase, mitochondrial
Description of Target:
ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACO2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACO2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...