Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ACO2 antibody - C-terminal region (ARP56302_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP56302_P050-FITC Conjugated

ARP56302_P050-HRP Conjugated

ARP56302_P050-Biotin Conjugated

Gene Symbol:
ACO2
NCBI Gene Id:
50
Official Gene Full Name:
Aconitase 2, mitochondrial
Protein Name:
Aconitate hydratase, mitochondrial
Swissprot Id:
Q99798
Protein Accession #:
NP_001089
Nucleotide Accession #:
NM_001098
Alias Symbols:
ACONM, MGC20605, MGC33908
Replacement Item:
This antibody may replace item sc-130677, HPA001097
Description of Target:
ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Protein Size (# AA):
780
Molecular Weight:
82kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACO2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACO2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ACO2
Species Reactivity:
Cow, Human, Pig, Rat, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%; Yeast: 100%
Complete computational species homology data:
Anti-ACO2 (ARP56302_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; UBC; SUMO1; NEDD8; MDM2; ASB9; VCAM1; ITGA4; AK3; SIN3A; ACAA2; APP; ACAT1; ATXN1L; SUMO4; PSMD4; SRRM2;
Blocking Peptide:
For anti-ACO2 (ARP56302_P050) antibody is Catalog # AAP56302 (Previous Catalog # AAPP34418)
Datasheets/Manuals:
Printable datasheet for anti-ACO2 (ARP56302_P050) antibody
Sample Type Confirmation:

ACO2 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Publications:

Scheving, R. et al. Protein S-nitrosylation and denitrosylation in the mouse spinal cord upon injury of the sciatic nerve. J. Proteomics 75, 3987-4004 (2012). IHC, WB, Cow, Human, Pig, Rat, Yeast 22588120

Tell us what you think about this item!

Write A Review
    Please, wait...