Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP42737_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42737_P050-FITC Conjugated

ARP42737_P050-HRP Conjugated

ARP42737_P050-Biotin Conjugated

ACLY Antibody - middle region (ARP42737_P050)

Catalog#: ARP42737_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-30537, HPA022434
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACLY
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
Complete computational species homology data Anti-ACLY (ARP42737_P050)
Peptide Sequence Synthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACLY (ARP42737_P050) antibody is Catalog # AAP42737 (Previous Catalog # AAPP24961)
Datasheets/Manuals Printable datasheet for anti-ACLY (ARP42737_P050) antibody
Sample Type Confirmation

ACLY is strongly supported by BioGPS gene expression data to be expressed in ACHN

Target Reference 0
Publications

Infantino, V., Iacobazzi, V., Palmieri, F. & Menga, A. ATP-citrate lyase is essential for macrophage inflammatory response. Biochem. Biophys. Res. Commun. 440, 105-11 (2013). WB, IHC, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 24051091

Gene Symbol ACLY
Official Gene Full Name ATP citrate lyase
Alias Symbols ACL, ATPCL, CLATP
NCBI Gene Id 47
Protein Name ATP-citrate synthase
Description of Target ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acety
Swissprot Id P53396
Protein Accession # NP_001087
Nucleotide Accession # NM_001096
Protein Size (# AA) 1101
Molecular Weight 121kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACLY.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACLY.
Protein Interactions UBC; UBR4; SIRT2; HUWE1; ISG15; KAT2B; SUMO2; SUMO3; STAU1; SUMO1; NEDD8; MDM2; ASB15; WWOX; TRIM25; MAGED2; BAG3; PPP6C; NCL; MCM6; MCM2; KPNA4; KPNA2; PRMT1; CDKN2A; SRRT; UBD; FN1; APP; SHC1; CUL3; CAND1; CUL2; SIRT7; UL27; HDAC5; TERF2; TERF1; GSK3B;
Write Your Own Review
You're reviewing:ACLY Antibody - middle region (ARP42737_P050)
Your Rating