Catalog No: ARP42737_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ACLY (ARP42737_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ACLY
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACLY (ARP42737_P050) antibody is Catalog # AAP42737 (Previous Catalog # AAPP24961)
Sample Type Confirmation

ACLY is strongly supported by BioGPS gene expression data to be expressed in ACHN


Acetyl-CoA Metabolism Supports Multistep Pancreatic Tumorigenesis. Cancer Discov. 9, 416-435 (2019). 30626590

Infantino, V., Iacobazzi, V., Palmieri, F. & Menga, A. ATP-citrate lyase is essential for macrophage inflammatory response. Biochem. Biophys. Res. Commun. 440, 105-11 (2013). 24051091

Gene SymbolACLY
Gene Full NameATP citrate lyase
Alias SymbolsACL, ATPCL, CLATP
NCBI Gene Id47
Protein NameATP-citrate synthase
Description of TargetATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acety
Uniprot IDP53396
Protein Accession #NP_001087
Nucleotide Accession #NM_001096
Protein Size (# AA)1101
Molecular Weight121kDa
  1. What is the species homology for "ACLY Antibody - middle region (ARP42737_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "ACLY Antibody - middle region (ARP42737_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACLY Antibody - middle region (ARP42737_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACLY Antibody - middle region (ARP42737_P050)"?

    This target may also be called "ACL, ATPCL, CLATP" in publications.

  5. What is the shipping cost for "ACLY Antibody - middle region (ARP42737_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACLY Antibody - middle region (ARP42737_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACLY Antibody - middle region (ARP42737_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "121kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACLY Antibody - middle region (ARP42737_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACLY"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACLY"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACLY"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACLY"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACLY"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACLY"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACLY Antibody - middle region (ARP42737_P050)
Your Rating
We found other products you might like!